�؋�����������������������������������������������������������������������������������X$��W��
�������������������������
�

 
�0hP�G�	?�5
RI
N�.�WW��eh�|��,�	?X!p!8!8!8���������������p�������8����������������8�����������������(!�!������������������������	��������
������������������������
��������������������������������������������������������������������������������P���������P
P
����������������h_(�	��@50���	�
�
��,8W�
@�X�pC�C ��(
!x!�)
"=�=#X�H�$��%(� ]
&p�� '�#(�C�3)@���*���+�
�, bh�-@ X .��������/��������08HPH1��������2�q�q3��������4��������5���6(���78y	��8��9(@:P��;8G�
<��
�<=����>����?�=
�=
@x��
A`�B�
�C@�	p�D��KE@�
��Fp���G�m
�H�0�IX��
J��K��L��H�M0��eNH��

O�zxP0���Q r��
R 2
�?
S���T�t�tU��)V��8�WH�
@X@��&Y�H@	Zxj��[�
 !\�H��]Ћx�
^����_py_`�
p�a�6H�b
`pc��	p�d@� e��������f��������g% %h�g�gi8+P+j�K�Kk�V��l���k
m�hwn���
o���=p��`�
q�I
0cr����sP��UtPd�3u��
Ȅ
vhR�Rw���
x����y�xX
z�p�B{0|X�@P}�L�[~���Gii�`�`��������I�
��8�8�px���F��gp�H[H$�py�%���Ph
��(#
��
��
��&��H�P���x6��
8���_�
�xD	�l�8<
XU��}(���lP�������������
��
����������(�������������x�������x������������������������������H
X����������������������H

��5
�?
�?
�?
`&���������������
����
h�!�T�T
 &�&H�����������������������H�����y��@����������������@������@	Packages@����������������������@�������������������������X��	?�I�����.5�$>����������������
.5-5/5
�sioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisionix��������T�8��������8������

 �8 	������������������������D�� Polax����������������x�xNamedename����������������p������@
0-8�����������������0�������X�ce�?dhat@���	V�Pola�$F����������������
V�W�U�
�hin the challenge handling
in multiprocessing.connection (patch 169; rhbz#879695)- fix a problem with distutils.sysconfig when CFLAGS is defined in the
environment (patch 168; rhbz#849994)- don't run any stack navigation tests in test_gdb for optimized builds
(patch 167; rhbz#912025)- s/cryptmodule/_cryptmodule/ in package payload (rhbz#835021)- bulletproof the gdb debugging hooks against a failure seen in ARM builds
(patch 166; rhbz#912025)
- re-enable make check on ARM (rhbz#912025)- backport pre-canned ways of salting a password to the "crypt" module from 3.3
(rhbz#835021)- remove "_default_patch_fuzz" directive to avoid patches being silently
misapplied (refresh patch 1, patch 101, patch 102, patch 111, patch 121,
patch 158; rename patch 1, patch 101, patch 121; apply patch 54 before the
lib64 patches to avoid fuzz problems caused by the conditional application
of the lib64 patches)- disable make check on ARM for the moment until 912025 is fixed- add aarch64 (rhbz#909783)- add BR on bluez-libs-devel (rhbz#879720)- remove f18 conditional from patch 159- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- fix memory leak in module _hashlib (patch 158, rhbz#836285)
- fix db4 include path for libdb4 package (f18 and above) (patch 159)- fix missing include in uid/gid handling patch (patch 157; rhbz#830405)- use rpm macro for power64 (rhbz#834653)- update uid/gid handling to avoid int overflows seen with uid/gid
values >= 2^31 on 32-bit architectures (patch 157; rhbz#697470)- renumber autotools patch from 300 to 5000
- specfile cleanups- try again to fix test_gdb.py (patch 156; rhbz#817072)- fix test_gdb.py (patch 156; rhbz#817072)- avoid allocating thunks in ctypes unless absolutely necessary, to avoid
generating SELinux denials on "import ctypes" and "import uuid" when embedding
Python within httpd (patch 155; rhbz#814391)- add explicit version requirements on expat to avoid linkage problems with
XML_SetHashSalt- fix -config symlinks (patch 112; rhbz#813836)- 2.7.3: refresh patch 102 (lib64); drop upstream patches 11 (ascii-to-lower),
115 (pydoc robustness), 145 (linux2), 148 (gdbm magic values), 151 (deadlock
in fork); refresh patch 112 (debug build); revise patch 127
(test_structmember); fix test_gdb (patch 153); refresh patch 137 (distutils
tests); add python2.pc to python-devel; regenerate the autotool intermediates
patch (patch 300)- fix deadlock issue (#787712)- Obsolete python-sqlite2- Build with $RPM_LD_FLAGS (#756862).
- Use xz-compressed source tarball.- Rebuilt for glibc bug#747377- re-enable gdbm (patch 148; rhbz#742242)- add a sys._debugmallocstats() function (patch 147)- support OpenSSL FIPS mode in _hashlib and hashlib; don't build the _md5 and
_sha* modules, relying on _hashlib in hashlib, and thus within md5 etc
(rhbz#563986; patch 146)- force sys.platform to be "linux2" (patch 145)- disable gdbm module to prepare for gdbm soname bump- rename and renumber patches for consistency with python3.spec (55, 111, 113,
114, 125, 131, 129 to 143)- rewrite of "check", introducing downstream-only hooks for skipping specific
cases in an rpmbuild (patch 132), and fixing/skipping failing tests in a more
fine-grained manner than before (patches 104, 133-142)- run selftests with "--verbose"
- disable parts of test_io on ppc (rhbz#732998)- add --extension-suffix option to python-config (patch 130; rhbz#732808)- re-enable and fix the --with-tsc option on ppc64, and rework it on 32-bit
ppc to avoid aliasing violations (patch 129; rhbz#698726)- don't use --with-tsc on ppc64 debug builds (rhbz#698726)- add rpm macros file (rhbz#731800)- cleanup of BuildRequires; add comment headings to specfile sections- reorganize test exclusions (test_openpty and test_pty seem to be failing on
every arch, not just the explicitly-listed ones)- add s390(x) excluded tests- 2.7.2; drop upstreamed patches: patch 122 (parallel make fix), patch 124
(test_commands and SELinux), patch 130 (ppc preprocessor macro in debug
build); patch 131 (decimal in Turkish locale);�x����������������������X�, �?64, (�X5nami�$����������������
555
�strippedASCII text, with very long linestroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)XML 1.0 document textUTF-8 Unicode text, with very long lines#6Nfx������



/
0
1
?
S
f
p
w
�
�
�
�
�
�
�
�
�
�
�
�
�
�!4OZhw����������!'4>KZhv��������%,15QZbpw������




					




		42R)RARLRKRFR$R5RRRRRRR4R8R<R#R&ROR@R-R(RRWRFRRRRR4R@R-R(RRWR)RAR$R5RRRRR4R8R<R#R&ROR@R-R(RRWR)RAR9R.R$R5R6RRRRRRR4R8R<R#R&ROR@R-R(RRWR)RAR9R.R$R5R6RRRRRRR4R8R<R#R&ROR@R-R(RRWR9R.R5R6RRRRRRR4ROR8R@R-R(RRWR)RAR9R.R$R5R6RRR�x������������� ��������X��?>	`��$p����������������
`�a�_�
�kg-config/usr/bin/python2.7libpython2.7.so.1.0()(64bit)pkgconfigpython-rpm-macrospython2(x86-64)python2-libs(x86-64)python2-rpm-macrospython2-setuptoolspython3-rpm-generatorsredhat-rpm-configrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)2.7.18-17.module+el8.10.0+1813+4b021305.rocky.0.22.7.18-17.module+el8.10.0+1813+4b021305.rocky.0.23.0.4-14.6.0-14.0-15.2-1python22.7.18-17.module+el8.10.0+1813+4b021305.rocky.0.24.14.3fO/�ehy@e'�e@d�!�c��c��@b�l�b[@a��aI�@a�`��@`y|@`
�@_��_�P�_�P�_:q@]�@�]nU�]G@\���\�Q�\��\��\��@\�-@\��@\�}�\��@\k�\�@\�@\��[��@[�[��[��[�/�[���[���[���[�;@[�F�[��[�]�[l,�[b�@[a��[�@Z��Z�V�Z�m�Z�Z��Z��@Z���Z�S�Z�v@Z}�@Zp^@Zc/@Z_:�Z]�@ZWQ�Z.s@ZC@Y��Y�d�Y��@Y�3�Y���Y��@Y�@Yy�YP�@Y.�@Y��Y�Y�X�:@X��@X��@X�+�X��X���Xwo�Xv@X�@W�%�W�@W�i�W�@W��W��W�9�W��@W��W��Wb��W^�@V�=@V�<@V��@Vp�V�@V�@V
B�U�6@U�6@U��@U���U�3@U��@U�a@Uc�UH��U.R�T�E@T�s@T�s@T�-@TԬ�T�C@T�C@T��@T��@Ts�Td�@T`��T\�@S��@S�<@S�@S�/�S�@S��@S��S���S�
@S���S|�@Sl�@SK�SB�@S��R��@R��@R��@R�x@R�&�R�@RS�R%�@RC@R�Q�B@Qک�Qک�Q��@Q�'@Q�U@Qu&@Qf��Qb�@QP<@Q7/�Q7/�Q4��Q4��Q']�Q']�Q']�Q&@Q&@Q$��Q$��Q$��Q$��Q$��Q$��Q#i@Q#i@Q#i@Q"�Q�@P�N@P#�@P��PS�O�@O�^@O�E@O��O�~�O�~�O�O�O��@O���O�r@OH�@O>A@N�1�N��@N��@Ns:@Np�@Np�@NoE�Nm�@NkQ@N_s�NS�@NS�@NS�@NL��N�@N
�@M���M���M��M�L@M�>�MR��M9u@M'@M'@M%��M9�L�*@L��@L���L��L��@Lk�@LMx�LMx�LH2�LH2�L5��L5��L3�L ��L ��L ��LT@L0�L
<@L�K�^�K�
@K���K�@K�@KՀ@K�@K�9@K�P@K���K�[�K�g@K�r�K�,�K��@Ks�@Kr��KqN@KqN@Ko��Ko��Kl@Kb�K^�@K]��K]��K]��KY�@KV�@KTM@KPX�K(�J���J�J�@J��@Jm��JlE@JOD@JG[@I��@I���I��@Ipv�IcG�I?�@I/�@H��H4@Hu��HU@G��G��@G��G��G��@G�@G~�GY5�GS�GO�@G'�G3�G��G��F�w�F�1�F�@F��@F��@F�S@F�.�F�Q@F���Fzh@F^��E�{@EѨ@E��@E��@E��@E���E��@E�@E~��E}H@Ev��Eu_@EE�@E<��D�D�*@D��D���D���D���D���D�W@D�W@D�@D��Dhm@D<�D5�C�@C�@C�C��C�q�C�Cy�Cq�C7�C7�C6�@C3�@C2��C2��C/��B�%�BfD@BS�@B5|�B1�@B��A�@A�I�A�U@A��@A�T@A�_�A�_�A��A��A�v�A~<@A4h@A�@A~@A
8@@��@Ū@@�X�@�d@@�z@@�(�@V�@@Dw@@,�@?��@?�@?٭�?��@?�8�?��?� �?�,@?��@?��@?r�?p5�?'�@?�>�v�>��>�@>��>��>Z	@>Z	@>T�@>G�@>BN@>@��>:e@>9�>9�>.��>%M@>�@>{@>)�=��@=��@=�@=�y@=ϛ�=Dz�=�a@=�l�=��@=o^@=X�=Q�=?�@==E@=)~�=)~�=@=
�@=�@<��<�6�<۶@<�*@<�L�<�@<��@<��@<��@<���<�@<�@<m@<m@<z'@<t�@<Y1�<V��<QH�<O�@<Ek@<)��<�<�<.�;�;�P@;��;�	@;��@;���;�N@;w�@;Yn�;X@;8y@;��:@�@::�::�9��9�@9�m@9Џ�9��Release Engineering <releng@rockylinux.org> - 2.7.18-17.rocky.0.2Lumír Balhar <lbalhar@redhat.com> - 2.7.18-17Lumír Balhar <lbalhar@redhat.com> - 2.7.18-16Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-15Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-14Josef Ridky <jridky@redhat.com> - 2.7.18-13Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-12Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-11Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-10Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-9Lumír Balhar <lbalhar@redhat.com> - 2.7.18-8Tomas Orsava <torsava@redhat.com> - 2.7.18-7Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-6Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-5Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-4Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-3Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-2Charalampos Stratakis <cstratak@redhat.com> - 2.7.18-1Tomas Orsava <torsava@redhat.com> - 2.7.17-2Charalampos Stratakis <cstratak@redhat.com> - 2.7.17-1Tomas Orsava <torsava@redhat.com> - 2.7.16-12Miro Hrončok <mhroncok@redhat.com> - 2.7.16-11Charalampos Stratakis <cstratak@redhat.com> - 2.7.16-10Charalampos Stratakis <cstratak@redhat.com> - 2.7.16-9Charalampos Stratakis <cstratak@redhat.com> - 2.7.16-8Charalampos Stratakis <cstratak@redhat.com> - 2.7.16-7Tomas Orsava <torsava@redhat.com> - 2.7.16-6Charalampos Stratakis <cstratak@redhat.com> - 2.7.16-5Tomas Orsava <torsava@redhat.com> - 2.7.16-4Charalampos Stratakis <cstratak@redhat.com> - 2.7.16�x����������������������X�N?��������x�$h����������������
x:��	
���������������xsgbVQE@4/#

���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#





�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					���������ix endianness annotations (Jaroslav Kysela) [1797509]
- [sound] ALSA: ctxfi: Remove unnecessary cast in kfree (Jaroslav Kysela) [1797509]
- [sound] ALSA: ali5451: remove redundant variable capture_flag (Jaroslav Kysela) [1797509]
- [sound] ALSA: dummy: Use standard macros for fixing PCM format cast (Jaroslav Kysela) [1797509]
- [sound] ALSA: aloop: Fix PCM format assignment (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm: Use a macro for parameter masks to reduce the needed cast (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm: Minor refactoring (Jaroslav Kysela) [1797509]
- [sound] ALSA: dmaengine_pcm: No need to take runtime reference twice in pcm_pointer (Jaroslav Kysela) [1797509]
- [sound] ALSA: dmaengine_pcm: Consider DMA cache caused delay in pointer callback (Jaroslav Kysela) [1797509]
- [sound] ALSA: dmaengine_pcm: Consider DMA cache caused delay in pointer callback (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm_dmaengine: Use pcm_for_each_format() macro for PCM format iteration (Jaroslav Kysela) [1797509]
- [sound] ALSA: core: Replace zero-length array with flexible-array member (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm: Fix superfluous snprintf() usage (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm: oss: Place the plugin buffer overflow checks correctly (for 5.7) (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm: oss: Fix regression by buffer overflow fix (again) (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm: oss: Remove WARNING from snd_pcm_plug_alloc() checks (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm: oss: Simplify plugin frame size calculations (Jaroslav Kysela) [1797509]
- [sound] ALSA: pcm: oss: Avoid plugin buffer overflow (Jaroslav Kysela) [1797509]
- [sound] ALSA: info: remove redundant assignment t���?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
����?R�#
��q��E8E
�����9�
�� ĉ�
�D��<	

��q�_�`7
����k�X

����
�
�����E
�ۋb���
����C��
����/�=
��ž̍
����KJ�

�!�a�4
�����|��
��g+
hf

�����Ȝ

��g�*
�P
��������
���Eb44F
����_lD
���EB4<N
�ۍڿ^�4
��h��<�

�ۍ�^p�
�ۍ�+_(�
��6�:$
�ۍ����
�ړ��!
�<
�ۍ�DA��
�ۍ�,t�
��F }�
�'�U�

��S�x.<b
���/�|&
�"^����f
��S��Oح

��S��;,�

��S����

��S�P�܊

�K=8���
��H`��0�
��q�l?
�

��q�$?
�

}�q��>
�

y�q��>
�

uK=#��\
u��KD
h���=�-

d��T�H

`�q��2
��
]���!
\|B�
�ި
[����"

X|B��'�ר
W�q�q��

U��XXH
T_[�i��


R�q��<
Q|^���

P_[��4
L


N|^��d-

L�q�'Il�

I|^� �

H�|ӱ�pϨ
G|^�%�� 
D|^��|"

@�q�(��e
=|^�
�H
<��a�
:G�B�$

8G��&�)

4��a�(
2�q���4^
1G��&8

0G�1� 
,G���

(���D


&�q�¯�+

%G��XLG
$Y�[X


 �q�]c�
Y�X�

�q�8dH

Y�u	�


D��(


�q�d��
Y��	�

u�w
�>

Y�:~8

u�'|`>

���A��
��ێ��4
��ۃR�*
���BR��
�x���������������������X��?(<
���������h�$r����������������
�h�h�h
�evin Fenzi <kevin@scrye.com> - 28.1.0-1Kevin Fenzi <kevin@scrye.com> - 28.0.0-1Kevin Fenzi <kevin@scrye.com> - 27.3.0-1Kevin Fenzi <kevin@scrye.com> - 27.2.0-1Kevin Fenzi <kevin@scrye.com> - 27.1.2-1Kevin Fenzi <kevin@scrye.com> - 26.0.0-1Kevin Fenzi <kevin@scrye.com> - 25.1.6-1Kevin Fenzi <kevin@scrye.com> - 25.1.1-1Kevin Fenzi <kevin@scrye.com> - 25.1.0-1Kevin Fenzi <kevin@scrye.com> - 25.0.0-1Kevin Fenzi <kevin@scrye.com> - 24.2.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 24.0.1-2Kevin Fenzi <kevin@scrye.com> - 24.0.1-1Kevin Fenzi <kevin@scrye.com> - 23.0.0-1Kevin Fenzi <kevin@scrye.com> - 22.0.5-1Kevin Fenzi <kevin@scrye.com> - 20.0.0-1Nils Philippsen <nils@redhat.com>Kevin Fenzi <kevin@scrye.com> - 21.2.2-1Kevin Fenzi <kevin@scrye.com> - 20.10.1-1Kevin Fenzi <kevin@scrye.com> - 20.9.0-1Kevin Fenzi <kevin@scrye.com> - 20.8.1-1Kevin Fenzi <kevin@scrye.com> - 20.6.7-1Kevin Fenzi <kevin@scrye.com> - 20.4-1Kevin Fenzi <kevin@scrye.com> - 20.3-1Kevin Fenzi <kevin@scrye.com> - 20.2.2-1Kevin Fenzi <kevin@scrye.com> - 20.1.1-1Kevin Fenzi <kevin@scrye.com> - 20.1-1Kevin Fenzi <kevin@scrye.com> - 20.0-1Kevin Fenzi <kevin@scrye.com> - 19.7-1Orion Poplawski <orion@cora.nwra.com> - 19.6.2-2Kevin Fenzi <kevin@scrye.com> - 19.6.2-1Kevin Fenzi <kevin@scrye.com> - 19.6-1Kevin Fenzi <kevin@scrye.com> - 19.5-1Kevin Fenzi <kevin@scrye.com> - 19.4-1Orion Poplawski <orion@cora.nwra.com> - 19.2-2Kevin Fenzi <kevin@scrye.com> - 19.2-1Kevin Fenzi <kevin@scrye.com> - 19.1.1-1Kevin Fenzi <kevin@scrye.com> - 18.8.1-1Kevin Fenzi <kevin@scrye.com> - 18.8-1Kevin Fenzi <kevin@scrye.com> - 18.7.1-1Kevin Fenzi <kevin@scrye.com> - 18.6.1-1Thomas Spura <tomspur@fedoraproject.org> - 18.5-3Robert Kuska <rkuska@redhat.com> - 18.5-2Robert Kuska <rkuska@redhat.com> - 18.5-1Robert Kuska <rkuska@redhat.coM> - 18.4-1Robert Kuska <rkuska@redhat.com> - 18.3.2-2Kevin Fenzi <kevin@scrye.com> 18.3.2-1Kevin Fenzi <kevin@scrye.com> 18.3.1-1Kevin Fenzi <kevin@scrye.com> 18.1-1Pierre-Yves Chibon <pingou@pingoured.fr> - 18.0.1-2Kevin Fenzi <kevin@scrye.com> 18.0.1-1Kevin Fenzi <kevin@scrye.com> 17.1.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 17.1.1-2Kevin Fenzi <kevin@scrye.com> 17.1.1-1Kevin Fenzi <kevin@scrye.com> 17.1-1Kevin Fenzi <kevin@scrye.com> 17.0-1Kevin Fenzi <kevin@scrye.com> 16.0-1Ralph Bean <rbean@redhat.com> - 15.2-1Ralph Bean <rbean@redhat.com> - 15.0-1Ralph Bean <rbean@redhat.com> - 14.3.1-1Ralph Bean <rbean@redhat.com> - 14.3.1-1Ralph Bean <rbean@redhat.com> - 14.3-1Ralph Bean <rbean@redhat.com> - 14.2-1Ralph Bean <rbean@redhat.com> - 14.1.1-1Ralph Bean <rbean@redhat.com> - 13.0.2-1Ralph Bean <rbean@redhat.com> - 12.4-1Ralph Bean <rbean@redhat.com> - 12.3-1Kevin Fenzi <kevin@scrye.com> 12.0.3-1Slavek Kabrda <bkabrda@redhat.com> - 11.3.1-2Kevin Fenzi <kevin@scrye.com> 11.3.1-1Kevin Fenzi <kevin@scrye.com> 11.0-1Kevin Fenzi <kevin@scrye.com> 8.2.1-1Ralph Bean <rbean@redhat.com> - 7.0-1Ralph Bean <rbean@redhat.com> - 6.1-1Ralph Bean <rbean@redhat.com> - 6.0.2-2Kevin Fenzi <kevin@scrye.com> 6.0.2-1Kevin Fenzi <kevin@scrye.com> 6.0.1-1Toshio Kuratomi <toshio@fedoraproject.org> - 2.0-8Toshio Kuratomi <toshio@fedoraproject.org> - 2.0-7Toshio Kuratomi <toshio@fedoraproject.org> - 2.0-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-5Matej Stuchlik <mstuchli@redhat.com> - 2.0-4Tomas Radej <tradej@redhat.com> - 2.0-3Matej Stuchlik <mstuchli@redhat.com> - 2.0-2Toshio Kuratomi <toshio@fedoraproject.org> - 2.0-1Toshio Kuratomi <toshio@fedoraproject.org> - 1.4-1Toshio Kuratomi <toshio@fedoraproject.org> - 1.3.1-1Toshio Kuratomi <toshio@fedoraproject.org> - 1.3-1Toshio Kuratomi <toshio@fedoraproject.org> - 1.1.7-1Toshio Kuratomi <toshio@fedoraproject.org> - 1.1.6-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.9.6-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.9.6-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.9.5-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.8-1Tosx�����P�������(t������DDD����������8x������
 `�`	����������������������|�įk,&C�q��������������������Providename[�@@x����������������r������@
AJ���������������hr�������X�ol�?<rem��
H��������43.33�$e����������������
�4�4�4
�bramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Bjorn Munch <bjorn.munch@oracle.com> - 5.7.6-0.1.m16Erlend Dahl <erlend.dahl@oracle.com> - 5.7.5-0.6.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.5.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.4.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.3.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.2.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.1.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.5.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.4.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.3.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.2.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.1.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.3-0.3.m13Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.3-0.1.m13Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.15-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-2Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-5Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-4Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-2 Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-9Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-8Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-7Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-6Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-5Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-4Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-2Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-1Joerg Bruehe <joerg.bruehe@oracle.com>Bjorn Munch <bjorn.munch@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Brajmohan Saxena <brajmohan.saxena@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Daniel Fischer <daniel.fischer@oracle.com>Tor Didriksen <tor.didriksen@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Daniel Fischer <daniel.fischer@oracle.com>Chuck Bell <chuck.bell@oracle.com>Sunanda Menon <sunanda.menon@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Georgi Kodinov <georgi.godinov@oracle.com>Georgi Kodinov <georgi.godinov@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@sun.com>Jonathan Perkin <jonathan.perkin@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Magnus B�x��������������a�������X����?������
�
������$s����������������
���
�lin Dahyabhai <nalin@redhat.com> 1.2.3-3Nalin Dahyabhai <nalin@redhat.com> 1.2.3-2Nalin Dahyabhai <nalin@redhat.com> 1.2.3-1Nalin Dahyabhai <nalin@redhat.com> 1.2.2-14Nalin Dahyabhai <nalin@redhat.com> 1.2.2-13Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Than Ngo <than@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>- Do not block HMAC-MD4/5 in FIPS mode
  Resolves: RHEL-86786
- Don't issue RC4 session keys by default (CVE-2025-3576)
  Resolves: RHEL-88049
- Add PKINIT paChecksum2 from MS-PKCA v20230920
  Resolves: RHEL-82648- Prevent overflow when calculating ulog block size (CVE-2025-24528)
  Resolves: RHEL-78248
- kdb5_util: fix DB entry flags on modification
  Resolves: RHEL-56060- libkrad: implement support for Message-Authenticator (CVE-2024-3596)
  Resolves: RHEL-50253
- Remove RSA protocol for PKINIT
  Resolves: RHEL-17616- CVE-2024-37370 CVE-2024-37371
  Fix vulnerabilities in GSS message token handling
  Resolves: RHEL-45398 RHEL-45386- Fix leak of default credentials in gss_inquire_cred()
  Resolves: RHEL-32258- Fix memory leak in GSSAPI interface
  Resolves: RHEL-27250
- Fix memory leak in PMAP RPC interface
  Resolves: RHEL-27244
- Make TCP waiting time configurable
  Resolves: RHEL-17131- Allow to make AD-SIGNEDPATH optional
  Resolves: RHEL-10514- Bump release number- Remove downloadable source signature file
- Resolves: rhbz#2219654- Support PAC with KDC extended signature and without ticket signature
- Resolves: rhbz#2169477- Fix integer overflows in PAC parsing (CVE-2022-42898)
- Resolves: rhbz#2140968-�x�������������HQ�������X��	?hv���a������;5hv�$+����������������
;5:5<5
�resources//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pkg_resources/_vendor//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pkg_resources/_vendor/packaging//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pkg_resources/extern//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pkg_resources/tests//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pkg_resources/tests/data//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pkg_resources/tests/data/my-test-package-source//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pyOpenSSL-23.2.0.dist-info//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pycparser-2.21.dist-info//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pycparser//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pycparser/ply//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pymysql//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pymysql/constants//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools-59.6.0.dist-info//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_distutils//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_distutils/command//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_vendor//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_vendor/more_itertools//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_vendor/packaging//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/command//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/extern//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel-0.37.1.dist-info//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel/cli//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel/vendored//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel/vendored/packaging//opt/lc/lwdbadmin/virtualenv/lib64//opt/lc/lwdbadmin/virtualenv/lib64/python3.6//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/PyYAML-6.0.1.dist-info//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/_yaml//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cffi-1.15.1.dist-info//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cffi//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography-40.0.2.dist-info//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/backends//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/backends/openssl//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/bindings//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/bindings/_rust//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/bindings/_rust/openssl//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/bindings/openssl//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/asymmetric//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/ciphers//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/kdf//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/serialization//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/twofactor//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/x509//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/psycopg2-2.�x��������������@�������X�b3�?4cb2h8d�8f3b�$z����������������
���
�bbie Harwood <rharwood@redhat.com> - 1.18.2-2Robbie Harwood <rharwood@redhat.com> - 1.18.2-1Robbie Harwood <rharwood@redhat.com> - 1.18.1-3Robbie Harwood <rharwood@redhat.com> - 1.18.1-2Robbie Harwood <rharwood@redhat.com> - 1.18.1-1Robbie Harwood <rharwood@redhat.com> - 1.18-1Robbie Harwood <rharwood@redhat.com> - 1.17-18Robbie Harwood <rharwood@redhat.com> - 1.17-17Robbie Harwood <rharwood@redhat.com> - 1.17-16Robbie Harwood <rharwood@redhat.com> - 1.17-15Robbie Harwood <rharwood@redhat.com> - 1.17-14Robbie Harwood <rharwood@redhat.com> - 1.17-13Robbie Harwood <rharwood@redhat.com> - 1.17-12Robbie Harwood <rharwood@redhat.com> - 1.17-11Robbie Harwood <rharwood@redhat.com> - 1.17-10Robbie Harwood <rharwood@redhat.com> - 1.17-9Robbie Harwood <rharwood@redhat.com> - 1.17-8Robbie Harwood <rharwood@redhat.com> - 1.17-7Robbie Harwood <rharwood@redhat.com> - 1.17-6Robbie Harwood <rharwood@redhat.com> - 1.17-5Robbie Harwood <rharwood@redhat.com> - 1.17-4Robbie Harwood <rharwood@redhat.com> - 1.17-3Robbie Harwood <rharwood@redhat.com> - 1.17-2Robbie Harwood <rharwood@redhat.com> - 1.17-1Robbie Harwood <rharwood@redhat.com> - 1.16.1-22Robbie Harwood <rharwood@redhat.com> - 1.16.1-21Robbie Harwood <rharwood@redhat.com> - 1.16.1-20Robbie Harwood <rharwood@redhat.com> - 1.16.1-19Robbie Harwood <rharwood@redhat.com> - 1.16.1-18Robbie Harwood <rharwood@redhat.com> - 1.16.1-17Robbie Harwood <rharwood@redhat.com> - 1.16.1-16Robbie Harwood <rharwood@redhat.com> - 1.16.1-15Robbie Harwood <rharwood@redhat.com> - 1.16.1-14Robbie Harwood <rharwood@redhat.com> - 1.16.1-13Robbie Harwood <rharwood@redhat.com> - 1.16.1-12Robbie Harwood <rharwood@redhat.com> - 1.16.1-11Robbie Harwood <rharwood@redhat.com> - 1.16.1-10Robbie Harwood <rharwood@redhat.com> - 1.16.1-9Robbie Harwood <rharwood@redhat.com> - 1.16.1-8Robbie Harwood <rharwood@redhat.com> - 1.16.1-7Robbie Harwood <rharwood@redhat.com> - 1.16.1-6Robbie Harwood <rharwood@redhat.com> - 1.16.1-5Robbie Harwood <rharwood@redhat.com> - 1.16.1-4Robbie Harwood <rharwood@redhat.com> - 1.16.1-3Robbie Harwood <rharwood@redhat.com> - 1.16.1-2Robbie Harwood <rharwood@redhat.com> - 1.16.1-1Robbie Harwood <rharwood@redhat.com> - 1.16-27Robbie Harwood <rharwood@redhat.com> - 1.16-26Robbie Harwood <rharwood@redhat.com> - 1.16-25Robbie Harwood <rharwood@redhat.com> - 1.16-24Robbie Harwood <rharwood@redhat.com> - 1.16-23Robbie Harwood <rharwood@redhat.com> - 1.16-22Robbie Harwood <rharwood@redhat.com> - 1.16-21Robbie Harwood <rharwood@redhat.com> - 1.16-20Robbie Harwood <rharwood@redhat.com> - 1.16-19Robbie Harwood <rharwood@redhat.com> - 1.16-18Robbie Harwood <rharwood@redhat.com> - 1.16-17Robbie Harwood <rharwood@redhat.com> - 1.16-16Robbie Harwood <rharwood@redhat.com> - 1.16-15Robbie Harwood <rharwood@redhat.com> - 1.16-14Robbie Harwood <rharwood@redhat.com> - 1.16-13Robbie Harwood <rharwood@redhat.com> - 1.16-12Robbie Harwood <rharwood@redhat.com> - 1.16-11Robbie Harwood <rharwood@redhat.com> - 1.16-10Robbie Harwood <rharwood@redhat.com> - 1.16-9Robbie Harwood <rharwood@redhat.com> - 1.16-8Robbie Harwood <rharwood@redhat.com> - 1.16-7Robbie Harwood <rharwood@redhat.com> - 1.16-6Fedora Release Engineering <releng@fedoraproject.org> - 1.16-5Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 1.16-4Robbie Harwood <rharwood@redhat.com> - 1.16-3Robbie Harwood <rharwood@redhat.com> - 1.16-2Robbie Harwood <rharwood@redhat.com> - 1.16-1Robbie Harwood <rharwood@redhat.com> - 1.16-0.beta2.1Robbie Harwood <rharwood@redhat.com> - 1.16-0.beta1.4Robbie Harwood <rharwood@redhat.com> - 1.16-0.beta1.3Robbie Harwood <rharwood@redhat.com> - 1.16-0.beta1.2Robbie Harwood <rharwood@redhat.com> - 1.16-0.beta1.1Robbie Harwood <rharwood@redhat.com> - 1.15.2-2Robbie Harwood <rharwood@redhat.com> - 1.15.2-1Robbie Harwood <rharwood@redhat.com> - 1.15.1-28Robbie Harwood <rharwood@redhat.com> - 1.15.1-27Robbie Harwood <rharwood@redhat.com> - 1.15.1-26Robbie Harwood <rharwood@redhat.com> - 1.15.1-25Robbie Harwood <rharwood@redh�x�������������X0�������X��?�+
��$G����������������
���
�  - drop patches for RT#5755, RT#6762, RT#6774, RT#6775
  - drop no-longer-needed backport patch for #539423
  - drop no-longer-needed patch for CVE-2010-1322
- if WITH_NSS is set, built with --with-crypto-impl=nss (requires NSS 3.12.9)- incorporate upstream patch to fix uninitialized pointer crash in the KDC's
  authorization data handling (CVE-2010-1322, #636335)- rebuild- pull down patches from trunk to implement k5login_authoritative and
  k5login_directory settings for krb5.conf (#539423)- Rebuilt for gcc bug 634757- fix reading of keyUsage extensions when attempting to select pkinit client
  certs (part of #629022, RT#6775)
- fix selection of pkinit client certs when one or more don't include a
  subjectAltName extension (part of #629022, RT#6774)- build with -fstack-protector-all instead of the default -fstack-protector,
  so that we add checking to more functions (i.e., all of them) (#629950)
- also link binaries with -Wl,-z,relro,-z,now (part of #629950)- fix a logic bug in computing key expiration times (RT#6762, #627022)- update to 1.8.3
  - drop backports of fixes for gss context expiration and error table
    registration/deregistration mismatch
  - drop patch for upstream #6750- tell krb5kdc and kadmind to create pid files, since they can
- add logrotate configuration files for krb5kdc and kadmind (#462658)
- fix parsing of the pidfile option in the KDC (upstream #6750)- libgssapi: pull in patch from svn to stop returning context-expired errors
  when the ticket which was used to set up the context expires (#605366,
  upstream #6739)- pull up fix for upstream #6745, in which the gssapi library would add the
  wrong error table but subsequently attempt to unload the right one- update to 1.8.2
  - drop patches for CVE-2010-1320, CVE-2010-1321- rebuild- ksu: move session management calls to before we drop privileges, like
  su does (#596887), and don't skip the PAM account check for root or the
  same user (more of #540769)- make krb5-server-ldap also depend on the same version-release of krb5-libs,
  as the other subpackages do, if only to make it clearer than it is when we
  just do it through krb5-server
- drop explicit linking with libtinfo for applications that use libss, now
  that readline itself links with libtinfo (as of readline-5.2-3, since
  fedora 7 or so)
- go back to building without strict aliasing (compiler warnings in gssrpc)- add patch to correct GSSAPI library null pointer dereference which could be
  triggered by malformed client requests (CVE-2010-1321, #582466)- fix output of kprop's init script's "status" and "reload" commands (#588222)- incorporate patch to fix double-free in the KDC (CVE-2010-1320, #581922)- fix a typo in kerberos.ldif- update to 1.8.1
  - no longer need patches for #555875, #561174, #563431, RT#6661, CVE-2010-0628
- replace buildrequires on tetex-latex with one on texlive-latex, which is
  the package that provides it now- kdc.conf: no more need to suggest a v4 mode, or listening on the v4 port- drop patch to suppress key expiration warnings sent from the KDC in
  the last-req field, as the KDC is expected to just be configured to either
  send them or not as a particular key approaches expiration (#556495)- add upstream fix for denial-of-service in SPNEGO (CVE-2010-0628, #576325)
- kdc.conf: no more need to suggest keeping keys with v4-compatible salting- remove the krb5-appl bits (the -workstation-clients and -workstation-servers
  subpackages) now that krb5-appl is its own package
- replace our patch for #563431 (kpasswd doesn't fall back to guessing your
  principal name using your user name if you don't have a ccache) with the
  one upstream uses- add documentation for the ticket_lifetime option (#561174)- pull up patch to get the client libraries to correctly perform password
  changes over IPv6 (Sumit Bose, RT#6661)- update to 1.8
  - temporarily bundling the krb5-appl package (split upstream as of 1.8)
    until its package review is complete
  - profile.d scriptlets are now only needed by -workstation-clie�x���������������������X�> �?0.2a��������(!�rød�$x����������������
���
�bie Harwood <rharwood@redhat.com> - 1.13.2-8Robbie Harwood <rharwood@redhat.com> - 1.13.2-7Roland Mainz <rmainz@redhat.com> - 1.13.2-6Roland Mainz <rmainz@redhat.com> - 1.13.2-5Roland Mainz <rmainz@redhat.com> - 1.13.2-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.13.2-3Roland Mainz <rmainz@redhat.com> - 1.13.2-2Roland Mainz <rmainz@redhat.com> - 1.13.2-1Roland Mainz <rmainz@redhat.com> - 1.13.2-0Roland Mainz <rmainz@redhat.com> - 1.13.1-4Roland Mainz <rmainz@redhat.com> - 1.13.1-3Roland Mainz <rmainz@redhat.com> - 1.13.1-2Roland Mainz <rmainz@redhat.com> - 1.13.1-1Roland Mainz <rmainz@redhat.com> - 1.13-8Roland Mainz <rmainz@redhat.com> - 1.13-7Nathaniel McCallum <npmccallum@redhat.com> - 1.13-6Roland Mainz <rmainz@redhat.com> - 1.13-5Roland Mainz <rmainz@redhat.com> - 1.13-4Roland Mainz <rmainz@redhat.com> - 1.13-3Roland Mainz <rmainz@redhat.com> - 1.13-2Roland Mainz <rmainz@redhat.com> - 1.13-1Roland Mainz <rmainz@redhat.com> - 1.13-0.alpha1.3Roland Mainz <rmainz@redhat.com> - 1.13-0.alpha1.3Nalin Dahyabhai <nalin@redhat.com> - 1.13-0.alpha1.3Nalin Dahyabhai <nalin@redhat.com> - 1.13-0.alpha1.2Nalin Dahyabhai <nalin@redhat.com> - 1.13-0.alpha1.1Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.12.2-2Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-1Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-14Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-13Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-12Tom Callaway <spot@fedoraproject.org> - 1.12.1-11Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-10Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-9Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.12.1-7Nathaniel McCallum <npmccallum@redhat.com> - 1.12.1-6Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-5Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-4Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-2Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-1Nalin Dahyabhai <nalin@redhat.com> - 1.12-11Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.12-10Nalin Dahyabhai <nalin@redhat.com> - 1.12-9Nalin Dahyabhai <nalin@redhat.com> - 1.12-8Nalin Dahyabhai <nalin@redhat.com> - 1.12-7Nalin Dahyabhai <nalin@redhat.com> - 1.12-6Nalin Dahyabhai <nalin@redhat.com> - 1.12-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.12-4Nalin Dahyabhai <nalin@redhat.com> - 1.12-3Nalin Dahyabhai <nalin@redhat.com> - 1.12-2Nalin Dahyabhai <nalin@redhat.com> - 1.12-1Nalin Dahyabhai <nalin@redhat.com> - 1.12-beta2.0Nalin Dahyabhai <nalin@redhat.com> - 1.12-beta1.0Nalin Dahyabhai <nalin@redhat.com> - 1.11.4-2Nalin Dahyabhai <nalin@redhat.com> - 1.11.4-1Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-31Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-30Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-29Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-28Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-27Nalin Dahyabhai <nalin@redhat.com> - 1.12-alpha1.0Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-26Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-25Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-24Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-23Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-22Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-21Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-20Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-19Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-18Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-17Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-16Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-15Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-14Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-13Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-12Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.11.3-11Nalin Dahyabhai <nalin@redhat.com> 1.11.3-10Nalin Dahyabhai <nalin@redhat.com> 1.11.3-9Nalin Dahyabhai <nalin@redhat.com> 1.11.3-8Nalin Dahyabhai <nali�x�������������H�������X�pm�?Payl�����������orpml�$"����������������
�o�o
�
crypt.so.1.1.0.hmac.libcrypt.so.1.hmaclibcrypt.so.1libcrypt.so.1.1.0.build-id312e8f01976e58c74f881f3d9239efc7f5bdb0e9libxcryptNEWSREADMETHANKSlibxcryptAUTHORSCOPYING.LIBLICENSINGcrypt.5.gz/lib64//usr/lib//usr/lib/.build-id//usr/lib/.build-id/31//usr/share/doc//usr/share/doc/libxcrypt//usr/share/licenses//usr/share/licenses/libxcrypt//usr/share/man/man5/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu


ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=312e8f01976e58c74f881f3d9239efc7f5bdb0e9, strippeddirectoryUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)P
PPPRRRRRR
R
utf-8d2da8f733c670b82ca05cf5868bb94ac1e594e090c7fd1c917fe3adfebe102bb?���@

�3
!pQ�p�)�Tξ7��]�mtZ`agH�
	�]�mtZ`dy�rR$6h�ÐDB�2��,Ft��LNx���k�U�HjZdN�o�6n~��#?�J9C^R[�H�;�6�X��g���Q]��z�i��uU����S.��
b?Jy���.0�t�#�A�A#�n��ZX�gȔ��M�tMe�{�!�
��.P5�3h�� ����I�͑{�hk�y����e���ǩ������HI?�
�
y^8�7�ɼ
qq�˹�7įk^�S���ڀ��؈UҜQ�ѣ�Y
F���&χ��Xݿcƺ�8�E}��8q�&��{��z!s��c���T�EM�p���,��y�C�z�ȹoW��UY�FP���5�9A8���h�K�<p/���}E?z��A9�vӬw#���<,ފ0�� �&��+��s��H96^
�N��~2R��I|�i��|Ԝ�/�෥325Ա�?ɉ>-�
�s�Myy,����c3H���M]���[��r2��}C	c��,���D-����7�fʦ�y�K��gE�w(ߺ���r
���ȗD�3
!pQ�p�)�Tξ7��]�mtZ`agH�
	�]�mtZ` F���{�&�\�~��{\:Ƅ*����_�Q�w�W��n��b�*3��kQ4�0��4�e�ҴK����~��7��S)G�lE�
^�A������$(�a�z
��0G%��-
��dv�'k�{1�d���l޾�7
�5���$
d���]�����u�>mwC�0��/[;�%7���RY��u�G�kaO�P��#�?�,��b'78e隒wğ��!�l$�8?�c�e$m��Q����|
Y��֧TiTӇ:ld)�l.Ƕ����/�oS����Q/X�=�x�>��I|�*�d^��^Z� -j���[�$��I7�8C�)ŕm�0��*�K���O�8��N�+)�Y�����,y
��N�)X���$=��~�DQ���&'������ij�k98�U�Zh�X{���_���"�ק.��kbMX��j�28䆑
��P�:sn�˾�$�C�;&�.&[�:�g�J�[m��L���7��j�M��;�Hi��\�?}�i�28345e451b9f322a001aba3243cc84e93d2613f9203ae470c889f886c2adb94e23f5b02c2829deb1c2457528a09a3caec2f1f210a��A�a��$c_component_resume() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-component: add snd_soc_component_suspend() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-component: add snd_soc_component_trigger() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-component: add snd_soc_component_hw_free() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-component: add snd_soc_component_hw_params() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-component: add snd_soc_component_prepare() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-component: add snd_soc_component_close() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-component: add snd_soc_component_open() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-component: add snd_soc_component_get/put() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: add soc-component.c (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-pcm: remove soc_fill_silence() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-pcm: remove soc_rtdcom_copy_kernel() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: soc-pcm: remove soc_rtdcom_ack() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: amd: acp3x: use dma address for acp3x dma driver (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: amd: acp3x: use dma_ops of parent device for acp3x dma driver (Jaroslav Kysela) [1�x����������������������X�c9�?5b68���������������hdcdf�$x����������������
�h�h�h
�thon-36.opt-1.pycversion.cpython-36.pyc_compat.py_structures.pymarkers.pyrequirements.pyspecifiers.pyutils.pyversion.pypyparsing.pysix.pyarchive_util.pybuild_meta.pycommand__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycalias.cpython-36.opt-1.pycalias.cpython-36.pycbdist_egg.cpython-36.opt-1.pycbdist_egg.cpython-36.pycbdist_rpm.cpython-36.opt-1.pycbdist_rpm.cpython-36.pycbdist_wininst.cpython-36.opt-1.pycbdist_wininst.cpython-36.pycbuild_clib.cpython-36.opt-1.pycbuild_clib.cpython-36.pycbuild_ext.cpython-36.opt-1.pycbuild_ext.cpython-36.pycbuild_py.cpython-36.opt-1.pycbuild_py.cpython-36.pycdevelop.cpython-36.opt-1.pycdevelop.cpython-36.pycdist_info.cpython-36.opt-1.pycdist_info.cpython-36.pyceasy_install.cpython-36.opt-1.pyceasy_install.cpython-36.pycegg_info.cpython-36.opt-1.pycegg_info.cpython-36.pycinstall.cpython-36.opt-1.pycinstall.cpython-36.pycinstall_egg_info.cpython-36.opt-1.pycinstall_egg_info.cpython-36.pycinstall_lib.cpython-36.opt-1.pycinstall_lib.cpython-36.pycinstall_scripts.cpython-36.opt-1.pycinstall_scripts.cpython-36.pycpy36compat.cpython-36.opt-1.pycpy36compat.cpython-36.pycregister.cpython-36.opt-1.pycregister.cpython-36.pycrotate.cpython-36.opt-1.pycrotate.cpython-36.pycsaveopts.cpython-36.opt-1.pycsaveopts.cpython-36.pycsdist.cpython-36.opt-1.pycsdist.cpython-36.pycsetopt.cpython-36.opt-1.pycsetopt.cpython-36.pyctest.cpython-36.opt-1.pyctest.cpython-36.pycupload.cpython-36.opt-1.pycupload.cpython-36.pycupload_docs.cpython-36.opt-1.pycupload_docs.cpython-36.pycalias.pybdist_egg.pybdist_rpm.pybdist_wininst.pybuild_clib.pybuild_ext.pybuild_py.pydevelop.pydist_info.pyeasy_install.pyegg_info.pyinstall.pyinstall_egg_info.pyinstall_lib.pyinstall_scripts.pylauncher manifest.xmlpy36compat.pyregister.pyrotate.pysaveopts.pysdist.pysetopt.pytest.pyupload.pyupload_docs.pyconfig.pydep_util.pydepends.pydist.pyextension.pyextern__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycglibc.pyglob.pylaunch.pylib2to3_ex.pymonkey.pymsvc.pynamespaces.pypackage_index.pypep425tags.pypy27compat.pypy31compat.pypy33compat.pypy36compat.pysandbox.pyscript (dev).tmplscript.tmplsite-patch.pyssl_support.pyunicode_utils.pyversion.pywheel.pywindows_support.pyplatform-python-setuptoolsCHANGES.rstREADME.rstdeveloper-guide.txtdevelopment.txteasy_install.txtformats.txthistory.txtindex.txtpkg_resources.txtpython3.txtreleases.txtrequirements.txtroadmap.txtsetuptools.txtplatform-python-setuptoolsLICENSE/usr/lib/python3.6/site-packages/__pycache__//usr/lib/python3.6/site-packages//usr/lib/python3.6/site-packages/pkg_resources//usr/lib/python3.6/site-packages/pkg_resources/__pycache__//usr/lib/python3.6/site-packages/pkg_resources/_vendor//usr/lib/python3.6/site-packages/pkg_resources/_vendor/__pycache__//usr/lib/python3.6/site-packages/pkg_resources/_vendor/packaging//usr/lib/python3.6/site-packages/pkg_resources/_vendor/packaging/__pycache__//usr/lib/python3.6/site-packages/pkg_resources/extern//usr/lib/python3.6/site-packages/pkg_resources/extern/__pycache__//usr/lib/python3.6/site-packages/setuptools-39.2.0.dist-info//usr/lib/python3.6/site-packages/setuptools//usr/lib/python3.6/site-packages/setuptools/__pycache__//usr/lib/python3.6/site-packages/setuptools/_vendor//usr/lib/python3.6/site-packages/setuptools/_vendor/__pycache__//usr/lib/python3.6/site-packages/setuptools/_vendor/packaging//usr/lib/python3.6/site-packages/setuptools/_vendor/packaging/__pycache__//usr/lib/python3.6/site-packages/setuptools/command//usr/lib/python3.6/site-packages/setuptools/command/__pycache__//usr/lib/python3.6/site-packages/setuptools/extern//usr/lib/python3.6/site-packages/setuptools/extern/__pycache__//usr/share/doc//usr/share/doc/platform-python-setuptools//usr/share/licenses//usr/share/licenses/platform-python-setuptools/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fe�x�������������8������X�- �?64-1`NP�������hedha�$t����������������
�h�h�h
�nd make Python 2 optional to facilitate building
  the Python 2 and Python 3 modules.- Revert "Add --executable option to easy_install command"
  This enhancement is currently not needed and it can possibly
  collide with `pip --editable`option- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- update to 36.2.0. Fixes bug #1470908- update to 36.0.1. Fixes bug #1458093- update to 35.0.2. Fixes bug #1446622- Update to 35.0.1. Fixes bug #1440388- Update to 34.3.2. Fixes bug #1428818- Update to 34.3.0. Fixes bug #1426463- Add --executable option to easy_install command- Update to 34.2.0. Fixes bug #1421676- Update to 34.1.1. Fixes bug #1412268
- Fix License tag. Fixes bug #1412268
- Add Requires for fomerly bundled projects: six, packaging appdirs- Use python macros in build and install sections- Update to 32.3.1. Fixes bug #1409091- Update to 32.3.0. Fixes bug #1408564- Update to 32.2.0. Fixes bug #1400310- Enable tests- Update to 30.4.0. Fixes bug #1400310- Rebuild for Python 3.6 with wheel
- Disable tests- Rebuild for Python 3.6 without wheel- Update to 28.8.1. Fixes bug #1392722- Update to 28.7.1. Fixes bug #1389917- Update to 28.6.1. Fixes bug #1387071- Update to 28.6.0. Fixes bug #1385655- Update to 28.3.0. Fixes bug #1382971- Update to 28.2.0. Fixes bug #1381099- Update to 28.1.0. Fixes bug #1381066- Update to 28.0.0. Fixes bug #1380073- Update to 27.3.0. Fixes bug #1378067- Update to 27.2.0. Fixes bug #1376298- Update to 27.1.2. Fixes bug #1370777- Update to 26.0.0. Fixes bug #1370777- Update to 25.1.6. Fixes bug #1362325- Update to 25.1.1. Fixes bug #1361465- Update to 25.1.0- Update to 25.0.0- Update to 24.2.0. Fixes bug #1352734- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Update to 24.0.1. Fixes bug #1352532- Update to 23.0.0. Fixes bug #1346542- Update to 22.0.5. Fixes bug #1342706- Upgrade to 22.0.0- fix source URL- Update to 21.2.2. Fixes bug #1332357- Update to 20.10.1. Fixes bug #1330375- Update to 20.9.0. Fixes bug #1327827- Update to 20.8.1. Fixes bug #1325910- Update to 20.6.7. Fixes bug #1322836- Update to 20.4. Fixes bug #1319366- Update to 20.3. Fixes bug #1311967- Update to 20.2.2. Fixes bug #1311967- Update to 20.1.1. Fixes bug #130719- Update to 20.1. Fixes bug #1307000- Update to 20.0. Fixes bug #1305394- Update to 19.7. Fixes bug #1304563- Fix python3 package file ownership- Update to 19.6.2. Fixes bug #1303397- Update to 19.6.- Update to 19.5. Fixes bug #1301313- Update to 19.4. Fixes bug #1299288- Cleanup spec from python3-setuptools review- Update to 19.2. Fixes bug #1296755- Update to 19.1.1. Fixes bug #1292658- Update to 18.8.1. Fixes bug #1291678- Update to 18.8. Fixes bug #1290942- Update to 18.7.1. Fixes bug #1287372- Update to 18.6.1. Fixes bug #1270578- Try to disable zip_safe bug #1271776
- Add python2 subpackage- Add patch so it is possible to set test_args variable- Update to 18.5. Fixes bug #1270578- Update to 18.4. Fixes bug #1270578
- Build with wheel and check phase- Python3.5 rebuild: rebuild without wheel and check phase- Update to 18.3.2. Fixes bug #1264902- Update to 18.3.1. Fixes bug #1256188- Update to 18.1. Fixes bug #1249436- Explicitely provide python2-setuptools- Update to 18.0.1- Drop no longer needed Requires/BuildRequires on python-backports-ssl_match_hostname
- Fixes bug #1231325- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Update to 17.1.1. Fixes bug 1229507- Update to 17.1. Fixes bug 1229066- Update to 17- Update to 16- new version- new version- new version- new version- new version- new version- new version- new version- new version- new version- Update to 12.0.3- Huge spec cleanup
- Make spec buildable on all Fedoras and RHEL 6 and 7
- Make tests actually run- Update to 11.3.1. Fixes bugs: #1179393 and #1178817- Update to 11.0. Fixes bug #1178421- Update to 8.2.1. Fixes bug #1175229- Latest upstream.  Fixes bug #1154590.- Latest upstream.  Fixes bug #1152130.- M�x���������������������X�.�P?VR������!mV$�@�$1����������������
!m"m`�
�.18-1Remi Collet <remi@remirepo.net> - 7.4.18~RC1-1Remi Collet <remi@remirepo.net> - 7.4.17~RC1-1Remi Collet <remi@remirepo.net> - 7.4.16-1Remi Collet <remi@remirepo.net> - 7.4.16~RC1-1Remi Collet <remi@remirepo.net> - 7.4.15-1Remi Collet <remi@remirepo.net> - 7.4.15~RC2-2Remi Collet <remi@remirepo.net> - 7.4.15~RC2-1Remi Collet <remi@remirepo.net> - 7.4.14-1Remi Collet <remi@remirepo.net> - 7.4.14~RC1-1Remi Collet <remi@remirepo.net> - 7.4.13-2Remi Collet <remi@remirepo.net> - 7.4.13-1Remi Collet <remi@remirepo.net> - 7.4.13~RC1-1Remi Collet <remi@remirepo.net> - 7.4.12-1Remi Collet <remi@remirepo.net> - 7.4.12~RC1-1Remi Collet <remi@remirepo.net> - 7.4.11-1Remi Collet <remi@remirepo.net> - 7.4.11~RC1-1Remi Collet <remi@remirepo.net> - 7.4.10-1Remi Collet <remi@remirepo.net> - 7.4.10~RC1-1Remi Collet <remi@remirepo.net> - 7.4.9-1Remi Collet <remi@remirepo.net> - 7.4.9~RC1-1Remi Collet <remi@remirepo.net> - 7.4.8-2Remi Collet <remi@remirepo.net> - 7.4.8-1Remi Collet <remi@remirepo.net> - 7.4.8~RC1-2Remi Collet <remi@remirepo.net> - 7.4.8~RC1-1Remi Collet <remi@remirepo.net> - 7.4.7-1Remi Collet <remi@remirepo.net> - 7.4.7~RC1-1Remi Collet <remi@remirepo.net> - 7.4.6-2Remi Collet <remi@remirepo.net> - 7.4.6-1Remi Collet <remi@remirepo.net> - 7.4.6~RC1-1Remi Collet <remi@remirepo.net> - 7.4.5-1Remi Collet <remi@remirepo.net> - 7.4.5~RC1-1Remi Collet <remi@remirepo.net> - 7.4.4-1Remi Collet <remi@remirepo.net> - 7.4.4~RC1-1Remi Collet <remi@remirepo.net> - 7.4.3-1Remi Collet <remi@remirepo.net> - 7.4.3~RC1-1Remi Collet <remi@remirepo.net> - 7.4.2-2Remi Collet <remi@remirepo.net> - 7.4.2-1Remi Collet <remi@remirepo.net> - 7.4.2~RC1-1Remi Collet <remi@remirepo.net> - 7.4.1-1Remi Collet <remi@remirepo.net> - 7.4.1~RC1-1Remi Collet <remi@remirepo.net> - 7.4.0-1Remi Collet <remi@remirepo.net> - 7.4.0~rc6-34Remi Collet <remi@remirepo.net> - 7.4.0~rc5-33Remi Collet <remi@remirepo.net> - 7.4.0~rc4-32Remi Collet <remi@remirepo.net> - 7.4.0~rc4-31Remi Collet <remi@remirepo.net> - 7.4.0~rc4-30Remi Collet <remi@remirepo.net> - 7.4.0~rc4-29Remi Collet <remi@remirepo.net> - 7.4.0~rc4-28Remi Collet <remi@remirepo.net> - 7.4.0~rc3-27Remi Collet <remi@remirepo.net> - 7.4.0~rc3-26Remi Collet <remi@remirepo.net> - 7.4.0~rc3-25Remi Collet <remi@remirepo.net> - 7.4.0~rc3-24Remi Collet <remi@remirepo.net> - 7.4.0~rc3-23Remi Collet <remi@remirepo.net> - 7.4.0~rc2-22Remi Collet <remi@remirepo.net> - 7.4.0~rc2-21Remi Collet <remi@remirepo.net> - 7.4.0~rc2-19Remi Collet <remi@remirepo.net> - 7.4.0~rc1-18Remi Collet <remi@remirepo.net> - 7.4.0~beta4-17Remi Collet <remi@remirepo.net> - 7.4.0~beta2-16Remi Collet <remi@remirepo.net> - 7.4.0~beta1-15Remi Collet <remi@remirepo.net> - 7.4.0~beta1-14Remi Collet <remi@remirepo.net> - 7.4.0~alpha3-13Remi Collet <remi@remirepo.net> - 7.4.0~alpha3-12Remi Collet <remi@remirepo.net> - 7.4.0~alpha2-11Remi Collet <remi@remirepo.net> - 7.4.0~alpha1-10Remi Collet <remi@remirepo.net> - 7.4.0~alpha1-9Remi Collet <remi@remirepo.net> - 7.4.0~alpha1-8Remi Collet <remi@remirepo.net> - 7.4.0~DEV.20190612-7Remi Collet <remi@remirepo.net> - 7.4.0~DEV.20190605-6Remi Collet <remi@remirepo.net> - 7.4.0~DEV.20190529-5Remi Collet <remi@remirepo.net> - 7.4.0~DEV.20190528-4Remi Collet <remi@remirepo.net> - 7.4.0~DEV.20190522-3Remi Collet <remi@remirepo.net> - 7.4.0~DEV.20190521-2Remi Collet <remi@remirepo.net> - 7.4.0~DEV.20190521-1Remi Collet <remi@remirepo.net> - 7.4.0~DEV.20190520-1Remi Collet <remi@remirepo.net> - 7.3.6~RC1-2Remi Collet <remi@remirepo.net> - 7.3.6~RC1-1Remi Collet <remi@remirepo.net> - 7.3.5-2Remi Collet <remi@remirepo.net> - 7.3.5-1Remi Collet <remi@remirepo.net> - 7.3.5~RC1-1Remi Collet <remi@remirepo.net> - 7.3.4-3Remi Collet <remi@remirepo.net> - 7.3.4-2Remi Collet <remi@remirepo.net> - 7.3.4-1Remi Collet <remi@remirepo.net> - 7.3.4~RC1-2Remi Collet <remi@remirepo.net> - 7.3.4~RC1-1Remi Collet <remi@remirepo.net> - 7.3.3-1Remi Collet <remi@remirepo.net> - 7.3.3~RC1-2Remi Collet <remi@remirepo.net�x��������������������X�@
?@���������C

�$����������������
CCC
�ace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make�x����������������������X�'t�?ld, �����������23 (�$u����������������
���
�<nalin@redhat.com> 1.6.3-17Nalin Dahyabhai <nalin@redhat.com>Tom "spot" Callaway <tcallawa@redhat.com> 1.6.3-16Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.3-15Tom "spot" Callaway <tcallawa@redhat.com> 1.6.3-14Nalin Dahyabhai <nalin@redhat.com> 1.6.3-13Nalin Dahyabhai <nalin@redhat.com> 1.6.3-12Nalin Dahyabhai <nalin@redhat.com> 1.6.3-11Nalin Dahyabhai <nalin@redhat.com> 1.6.3-10Nalin Dahyabhai <nalin@redhat.com> 1.6.3-9Nalin Dahyabhai <nalin@redhat.com> 1.6.3-8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.3-7Nalin Dahyabhai <nalin@redhat.com> 1.6.3-6Nalin Dahyabhai <nalin@redhat.com> 1.6.3-5Nalin Dahyabhai <nalin@redhat.com> 1.6.3-4Nalin Dahyabhai <nalin@redhat.com> 1.6.3-3Nalin Dahyabhai <nalin@redhat.com> 1.6.3-2Nalin Dahyabhai <nalin@redhat.com> 1.6.3-1Nalin Dahyabhai <nalin@redhat.com> 1.6.2-10Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.2-9Nalin Dahyabhai <nalin@redhat.com> 1.6.2-8Nalin Dahyabhai <nalin@redhat.com> 1.6.2-7Nalin Dahyabhai <nalin@redhat.com> 1.6.2-6Nalin Dahyabhai <nalin@redhat.com> 1.6.2-5Nalin Dahyabhai <nalin@redhat.com> 1.6.2-4Nalin Dahyabhai <nalin@redhat.com> 1.6.2-3Nalin Dahyabhai <nalin@redhat.com> 1.6.2-2Nalin Dahyabhai <nalin@redhat.com> 1.6.2-1Nalin Dahyabhai <nalin@redhat.com> 1.6.1-8Nalin Dahyabhai <nalin@redhat.com> 1.6.1-7Nalin Dahyabhai <nalin@redhat.com> 1.6.1-6Nalin Dahyabhai <nalin@redhat.com> 1.6.1-5.1Nalin Dahyabhai <nalin@redhat.com> 1.6.1-5Nalin Dahyabhai <nalin@redhat.com> 1.6.1-4Nalin Dahyabhai <nalin@redhat.com> 1.6.1-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.1-2Nalin Dahyabhai <nalin@redhat.com> 1.6.1-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6-6Nalin Dahyabhai <nalin@redhat.com> 1.6-5Nalin Dahyabhai <nalin@redhat.com> 1.6-4Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.5-24Nalin Dahyabhai <nalin@redhat.com> 1.6-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6-2Nalin Dahyabhai <nalin@redhat.com> 1.5-23Nalin Dahyabhai <nalin@redhat.com> 1.5-22Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.5-20Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.5-18Nalin Dahyabhai <nalin@redhat.com> - 1.5-17Nalin Dahyabhai <nalin@redhat.com> - 1.5-16Nalin Dahyabhai <nalin@redhat.com> - 1.5-14Nalin Dahyabhai <nalin@redhat.com> - 1.5-12Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.5-11Nalin Dahyabhai <nalin@redhat.com> - 1.5-10Nalin Dahyabhai <nalin@redhat.com> - 1.5-9.pal_18695Nalin Dahyabhai <nalin@redhat.com> - 1.5-9Nalin Dahyabhai <nalin@redhat.com> - 1.5-8Nalin Dahyabhai <nalin@redhat.com> - 1.5-7Nalin Dahyabhai <nalin@redhat.com> - 1.5-6Nalin Dahyabhai <nalin@redhat.com> - 1.5-5Nalin Dahyabhai <nalin@redhat.com> - 1.5-4Nalin Dahyabhai <nalin@redhat.com> - 1.5-3Nalin Dahyabhai <nalin@redhat.com> - 1.5-2Nalin Dahyabhai <nalin@redhat.com> - 1.5-1.2Jesse Keating <jkeating@redhat.com> - 1.5-1.1Nalin Dahyabhai <nalin@redhat.com> 1.5-1Nalin Dahyabhai <nalin@redhat.com> 1.5-0Nalin Dahyabhai <nalin@redhat.com> 1.4.3-9Nalin Dahyabhai <nalin@redhat.com> 1.4.3-8Nalin Dahyabhai <nalin@redhat.com> 1.4.3-7Nalin Dahyabhai <nalin@redhat.com> 1.4.3-6Stepan Kasal <skasal@redhat.com> 1.4.3-5Jesse Keating <jkeating@redhat.com> 1.4.3-4.1Nalin Dahyabhai <nalin@redhat.com> 1.4.3-4Nalin Dahyabhai <nalin@redhat.com> 1.4.3-3Matthias Clasen <mclasen@redhat.com> 1.4.3-2Jesse Keating <jkeating@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.4.3-1Nalin Dahyabhai <nalin@redhat.com> 1.4.2-4Nalin Dahyabhai <nalin@redhat.com> 1.4.2-3Nalin Dahyabhai <nalin@redhat.com>�x���������������������X�e l?tion����������*
%{ui�$=����������������
�*
�*
�*

�l@redhat.com> 7.11.1-1Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Adrian Havill <havill@redhat.com> 7.10.6-7Adrian Havill <havill@redhat.com> 7.10.6-6Adrian Havill <havill@redhat.com> 7.10.6-5Adrian Havill <havill@redhat.com> 7.10.6-4.1Adrian Havill <havill@redhat.com> 7.10.6-4Joe Orton <jorton@redhat.com> 7.10.6-3Joe Orton <jorton@redhat.com> 7.10.6-2.2Adrian Havill <havill@redhat.com> 7.10.6-2.1Adrian Havill <havill@redhat.com> 7.10.6-2Adrian Havill <havill@redhat.com> 7.10.6-1Adrian Havill <havill@redhat.com> 7.10.5-1Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Joe Orton <jorton@redhat.com> 7.9.8-4Nalin Dahyabhai <nalin@redhat.com> 7.9.8-3Joe Orton <jorton@redhat.com> 7.9.8-2Trond Eivind Glomsrød <teg@redhat.com> 7.9.8-1Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 7.9.7-1Trond Eivind Glomsrød <teg@redhat.com> 7.9.6-1Trond Eivind Glomsrød <teg@redhat.com> 7.9.5-2Trond Eivind Glomsrød <teg@redhat.com> 7.9.5-1Trond Eivind Glomsrød <teg@redhat.com> 7.9.3-2Nalin Dahyabhai <nalin@redhat.com> 7.9.3-1Tim Powers <timp@redhat.com> 7.9.2-2Trond Eivind Glomsrød <teg@redhat.com> 7.9.2-1Nalin Dahyabhai <nalin@redhat.com>Crutcher Dunnavant <crutcher@redhat.com>Tim Powers <timp@redhat.com>Jeff Johnson <jbj@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Tim Powers <timp@redhat.com> Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Tim Powers <timp@redhat.com>Prospector <prospector@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>- cookie: don't treat the leading slash as trailing (CVE-2025-9086)
  Resolves: RHEL-121655- NTLM: force the connection to HTTP/1.1 (RHEL-73788)* crypto: ensure crypto initialization works (RHEL-102601)- libssh: Fix matching user-specified MD5 hex key (RHEL-94574)- asyn-thread: fix EBADF regression (RHEL-85602)- make up incomplete patch for host name wildcard checking (RHEL-5680)
- asyn-thread: issue CURL_POLL_REMOVE before closing socket (RHEL-85602)- asyn-thread: create a socketpair to wait on (RHEL-34906)
- fix crash, when talking to a NTLM proxy in FIPS mode (RHEL-32641)- provide common cleanup method for push headers (CVE-2024-2398)- fix incorrect backport of bz2229800 (RHEL-44684)- when keyboard-interactive auth fails, try password (#2229800)
- cap SFTP packet size sent (RHEL-5311)
- unify the upload/method handling (CVE-2023-28322)
- fix cookie injection with none file (CVE-2023-38546)
- fix HTTP2 connection failure with HTTP2 framing layer (RHEL-5657)
- lowercase the domain names before PSL checks (CVE-2023-46218)- fix host name wildcard checking (CVE-2023-28321)
- rebuild certs with 2048-bit RSA keys- sftp: do not specify O_APPEND when not in append mode (#2187717)- fix GSS delegation too eager connection re-use (CVE-2023-27536)
- fix FTP too eager connection reuse (CVE-2023-27535)- fix HTTP multi-header compression denial of service (CVE-2023-23916)- h2: lower initial window size to 32 MiB (#2166254)- smb/telnet: fix use-after-free when HTTP proxy denies tunnel (CVE-2022-43552)- upon HTTP_1_1_REQUIRED, retry the request with HTTP/1.1 (#2139337)- control code in cookie denial of service (CVE-2022-35252)- setopt: enable CURLOPT_SSH_KNOWNHOSTS and CURLOPT_SSH_KEYFUNCTION (#2063703)
- fix HTTP compression denial of service (CVE-2022-32206)
- fix FTP-KRB bad message verification (CVE-2022-32208)- fix too eager reuse of TLS and SSH connections (CVE-2022-27782)
- fix invalid type in printf() argument detected by Coverity- fix credential leak on redirect (CVE-2022-27774)
- fix auth/cookie leak on redirect (CVE-2022-27776)
- fix OAUTH2 bearer bypass in conne�x�������������p��������X�wr�?m> -��h�������L�nčo�$\����������������
L�K�Ր
�ry- Refresh mysql-install patch and service renaming- Updated to 5.6.14- Support upgrade from 5.5 ULN packages to 5.6- Enhanced perl filtering 
- Added openssl-devel to buildreq- Removed mysql_embedded binary to resolve multilib conflict issue- Fixed Provides and Obsoletes issues in server, test packages- Updated to 5.6.13- Added files list to embedded packages- Updated libmysqld.a with libmysqld.so in embedded package- Updated test package dependency from client to server- Added libs-compat dependency under libs package to resolve server
  installation conflicts issue.- Removed libmysqlclient.so.16 from libs package- Adjusted to work on OEL6- Move libs to mysql/
- Basic multi arch support
- Fix changelog dates- Major cleanup- Updated to 5.6.12- Allow to override the default to use the bundled yaSSL by an option like
      --define="with_ssl /path/to/ssl"- Replace old my-*.cnf config file examples with template my-default.cnf- Let the installation use the new option "--random-passwords" of "mysql_install_db".
  (Bug# 12794345 Ensure root password)
- Fix an inconsistency: "new install" vs "upgrade" are told from the (non)existence
  of "$mysql_datadir/mysql" (holding table "mysql.user" and other system stuff).- Add a macro "runselftest":
  if set to 1 (default), the test suite will be run during the RPM build;
  this can be oveeridden via the command line by adding
      --define "runselftest 0"
  Failures of the test suite will NOT make the RPM build fail!- Add the man page for the "mysql_config_editor".- Make sure newly added "SPECIFIC-ULN/" directory does not disturb packaging.- Removal all traces of the readline library from mysql (BUG 13738013)- Fix duplicate mentioning of "mysql_plugin" and its manual page,
  it is better to keep alphabetic order in the files list (merging!).- Let the RPM capabilities ("obsoletes" etc) ensure that an upgrade may replace
  the RPMs of any configuration (of the current or the preceding release series)
  by the new ones. This is done by not using the implicitly generated capabilities
  (which include the configuration name) and relying on more generic ones which
  just list the function ("server", "client", ...).
  The implicit generation cannot be prevented, so all these capabilities must be
  explicitly listed in "Obsoletes:"- Add support for Oracle Linux 6 and Red Hat Enterprise Linux 6.  Due to
  changes in RPM behaviour ($RPM_BUILD_ROOT is removed prior to install)
  this necessitated a move of the libmygcc.a installation to the install
  phase, which is probably where it belonged in the first place.- "make_win_bin_dist" and its manual are dropped, cmake does it different.- Add mysql_plugin man page.- Set CXX=g++ by default to add a dependency on libgcc/libstdc++.
  Also, remove the use of the -fno-exceptions and -fno-rtti flags.
  TODO: update distro_buildreq/distro_requires- Add the manual page for "mysql_plugin" to the server package.- Null-upmerge the fix of bug#37165: This spec file is not affected.
- Replace "/var/lib/mysql" by the spec file variable "%{mysqldatadir}".- Source plugin library files list from cmake-generated file.- Added the mysql_plugin client - enables or disables plugins.- Fix bug#12561297: Added the MySQL embedded binary- Fix bug#45415: "rpm upgrade recreates test database"
  Let the creation of the "test" database happen only during a new installation,
  not in an RPM upgrade.
  This affects both the "mkdir" and the call of "mysql_install_db".- Fix bug#56581: If an installation deviates from the default file locations
  ("datadir" and "pid-file"), the mechanism to detect a running server (on upgrade)
  should still work, and use these locations.
  The problem was that the fix for bug#27072 did not check for local settings.- Install the new "manifest" files: "INFO_SRC" and "INFO_BIN".- EXCEPTIONS-CLIENT has been deleted, remove it from here too
- Support MYSQL_BUILD_MAKE_JFLAG environment variable for passing
  a '-j' argument to make.- Added test authentication (WL#1054) plugin binaries- Ad�x��������������������X�ks-? dro��������Є�3aths�$d����������������
�3�3
�	enses//usr/share/licenses/libsolv/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu

directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3b032829f5aca7ee51f01bea69cd0b45a1fe64a0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ad88ade2b153e0641a8a06376de199c98dd20bb1, strippedASCII textPPPPPPPPRRRR	RRRRR
R
RPPR
RRRRRRRRRRRRRRRRRRRRR
Rutf-86734fb46f7a81c97c622d83d491b0f5149fe51e86e6e6b656bacf836d24d75b9?����ȉ3
!pQ�p�)�Tξ7��]�mtZ`ekK
	�]�mtZ`�r�G����I����L�[���t6�0�59 �r+�
����mK�#w�x>���p��˟��>[�k��P�If$��OYt;�bO�c�u��M�*�x&��<���9nD�4?���#&��E�!�H���RJ�G�]�W��3ۥx
O�X��>��;s#�_z���萙�Z)�2Y�v7�`�c�r��ݤ��~ڊ��������ϗ�y'�	3�A�m�d$�1�WɊ��M�/�NJ����+�ӣ�vs8gC�%�$"�.4�Л2��J T����xa D{ɺN�Y��igMpz"�����&�oBa啡�)�ޭz�S7�B�x�!S�����	~"��&_\u�C#(6m�����P��}KG�U?Δ��od���럴��NmY�U���FT�o��B_ʺ�<�1�2k���5�m�!ڤO�Q�_<�`p�8�&<o��M��
�*��BL]���JC�0��Gilu‘&L���@���9d	 �Lx����Y�'5��
�*�h�ӥ�3
!pQ�p�)�Tξ7��]�mtZ`ekK
	�]�mtZ`}
�5��t/�.1( ����+[[�8鞟|��B�Xc�~T�3+�=
{qS���
�%���c�����ê;�KlA�wz�t�E1���_8�.ˍΥ���I���!"8P-+��t/N���z����Ȓ�G?�C���U���Y��7�x1E���xp[{ۙ|��g<*α���2�K��:k��}��Y�^�I�/M���l�j�\��X��H9�������
�_H�A_^P[�?�<�+'����<gpW-�0ˡ� qHx�X&5�ٖ'a�$	L�Պu��9 9,N���HE��Jf7Z�|}kf{�Y�
$��p�Ł�����r�Q���|���|�d�mje�a0,����}[t%�Cq�yi�Όn��]���I�+c����V��
6���3[k�h�����ro��=70,-�ô7���()�F��Vѱ�px�J�R�skĒ�2�����.��>m�+�e���5x��3�

H��t𦅃�(���W����\87ff2fd50b50a48d4aa85a5b25fd4e0da709e3809edf7ab7398d17add494651c59d3a0a4c5b08e1792f02d9c2e5b11b761b81486em��J�em�� [1740778]
- [hid] redragon: fix num lock and caps lock LEDs (Benjamin Tissoires) [1740778]
- [hid] hid-ntrig: add error handling for sysfs_create_group (Benjamin Tissoires) [1740778]
- [hid] i2c-hid: Add vddl regulator control (Benjamin Tissoires) [1740778]
- [uapi] input: document meanings of KEY_SCREEN and KEY_ZOOM (Benjamin Tissoires) [1740778]
- [input] synaptics-rmi4 - avoid processing unknown IRQs (Benjamin Tissoires) [1740778]
- [input] revert "input: elantech - enable SMBus on new (2018+) systems" (Benjamin Tissoires) [1740778]
- [input] elantech - annotate fall-through case in elantech_use_host_notify() (Benjamin Tissoires) [1740778]
- [samples] treewide: Add SPDX license identifier - Makefile/Kconfig (Benjamin Tissoires) [1740778]
- [kernel] input: elan_i2c - remove Lenovo Legion Y7000 PnpID (Benjamin Tissoires) [1740778]
- [input] synaptics - enable RMI mode for HP Spectre X360 (Benjamin Tissoires) [1740778]
- [input] elantech - enable SMBus on new (2018+) systems (Benjamin Tissoires) [1740778]
- [input] treewide: Replace GPLv2 boilerplate/reference with SPDX - rule 500 (Benjamin Tissoires) [1740778]
- [kernel] treewide: Replace GPLv2 boilerplate/reference with SPDX - rule 234 (Benjamin Tissoires) [1740778]
- [input] hyperv-keyboard: Use in-place iterator API in the channel callback (Benjamin Tissoires) [1740778]
- [input] usbtouchscreen - initialize PM mutex before using it (Benjamin Tissoires) [1740778]
- [input] alps - fix a mismatch between a condition check and its comment (Benjamin Tissoires) [1740778]
- [input] psmouse - fix build error of multiple definition (Benjamin Tissoir�x�������������Pz�������X�~?��������� nGN�$W����������������
GNHNFN
�1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu



		ASCII textXML 1.0 document, ASCII textdirectoryPython script, ASCII text executablepython 3.6 byte-compiledELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0cfb0d77dd3a8198a22380bf13b29c485b28b3e4, strippedUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)empty
	

 !"#$%&'()*+,-./0123456789:DEF


























































RP
PRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
R"RRRutf-8cf5a488d405ea290b6db2ca5351245f054c2ddda4a8121d04bd14df6a72b5e09?������3
!pQ�p�)�Tξ7��]�mtZ`e^L7
	�]�mtZ`��C8?WɠS����m~v"����]�э�S a�{�����[�q\� T���d���.��Qn��U�x-�4'ZT�儳͑
T�M��g�
gȫ�GP��ѷ���[�
���awBU�U��t��A��aѾ�Q3�Ex����FZ���gQ�eV��%��@�����2�j�v3X�J�Ӣ��d��3����H}p�=�5���d)
Ʌ?i��j.��T�T��a�OȈ��,\��&z��:�V���%�2�	/+?Q�\��m�����Дx����,��
���p���v��̋�J^���4�0Ӫ��<�빕}e'X�&L���w����b��3[L�~|ȸ2�o4Wƶ�����>*�"��7����q$�vBB�?�2$Am\Q�ΠN�V0�b��P�opWG8�"j�^Rf����~����ш�S,rO"<"%�S�"?�LJ,yjT�.�giX�Q��95��T�]��<2ue�e�miʼn2eq!^�
����f�B��Pꣻ�!�D�@4d�9]�%�q��3
!pQ�p�)�Tξ7��]�mtZ`e^L7
	�]�mtZ`5��\e�4��}�|�%�)VX�?�O���

�!D�:�3�IˤJ����V9��3��@��6_�
A��_zw���	O\��eZ�'���Q��v������'c1��t�c+"�����$]	Èx�������������j�������X�an?B/ml����������$Cd fo�$4����������������
$C%C#C
�slano@redhat.com> - 5.3.8-3.2Peter Schiffer <pschiffe@redhat.com> - 5.3.8-3.1Remi Collet <remi@fedoraproject.org> 5.3.8-3Remi Collet <remi@fedoraproject.org> 5.3.8-2Remi Collet <remi@fedoraproject.org> 5.3.8-1Remi Collet <remi@fedoraproject.org> 5.3.7-1Joe Orton <jorton@redhat.com> - 5.3.6-4Remi Collet <Fedora@famillecollet.com> 5.3.6-3Remi Collet <Fedora@famillecollet.com> 5.3.6-2Remi Collet <Fedora@famillecollet.com> 5.3.6-1Joe Orton <jorton@redhat.com> - 5.3.5-6Caolán McNamara <caolanm@redhat.com> 5.3.5-5Remi Collet <Fedora@famillecollet.com> 5.3.5-4Remi Collet <Fedora@famillecollet.com> 5.3.5-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.5-2Remi Collet <Fedora@famillecollet.com> 5.3.5-1Remi Collet <rpms@famillecollet.com> 5.3.4-2Remi Collet <rpms@famillecollet.com> 5.3.4-1.1Remi Collet <Fedora@famillecollet.com> 5.3.4-1Remi Collet <Fedora@famillecollet.com> 5.3.3-5Joe Orton <jorton@redhat.com> - 5.3.3-4Joe Orton <jorton@redhat.com> - 5.3.3-3Remi Collet <Fedora@famillecollet.com> 5.3.3-2Remi Collet <Fedora@famillecollet.com> 5.3.3-1Remi Collet <Fedora@famillecollet.com> 5.3.2-3Caolán McNamara <caolanm@redhat.com> 5.3.2-2Remi Collet <Fedora@famillecollet.com> 5.3.2-1Joe Orton <jorton@redhat.com> - 5.3.1-3Joe Orton <jorton@redhat.com> - 5.3.1-2Remi Collet <Fedora@famillecollet.com> 5.3.1-1Tom "spot" Callaway <tcallawa@redhat.com> - 5.3.0-7Tomas Mraz <tmraz@redhat.com> - 5.3.0-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.0-5Joe Orton <jorton@redhat.com> 5.3.0-4Joe Orton <jorton@redhat.com> 5.3.0-3Joe Orton <jorton@redhat.com> 5.3.0-2Remi Collet <Fedora@famillecollet.com> 5.3.0-1Remi Collet <Fedora@famillecollet.com> 5.2.10-1Remi Collet <Fedora@FamilleCollet.com> - 5.2.9-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.2.8-10Joe Orton <jorton@redhat.com> 5.2.8-9Joe Orton <jorton@redhat.com> 5.2.8-8Joe Orton <jorton@redhat.com> 5.2.8-7Joe Orton <jorton@redhat.com> 5.2.8-5Joe Orton <jorton@redhat.com> 5.2.8-4Joe Orton <jorton@redhat.com> 5.2.8-3Remi Collet <Fedora@FamilleCollet.com> 5.2.8-2Remi Collet <Fedora@FamilleCollet.com> 5.2.8-1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1.1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1Joe Orton <jorton@redhat.com> 5.2.6-7Joe Orton <jorton@redhat.com> 5.2.6-6Remi Collet <Fedora@FamilleCollet.com> 5.2.6-5Remi Collet <Fedora@FamilleCollet.com> 5.2.6-4Joe Orton <jorton@redhat.com> 5.2.6-3Joe Orton <jorton@redhat.com> 5.2.5-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 5.2.5-6Joe Orton <jorton@redhat.com> 5.2.5-5Joe Orton <jorton@redhat.com> 5.2.5-4Release Engineering <rel-eng at fedoraproject dot org> - 5.2.5-3Joe Orton <jorton@redhat.com> 5.2.5-2Joe Orton <jorton@redhat.com> 5.2.4-3Joe Orton <jorton@redhat.com> 5.2.4-2Joe Orton <jorton@redhat.com> 5.2.3-9Joe Orton <jorton@redhat.com> 5.2.3-8Hans de Goede <j.w.r.degoede@hhs.nl> 5.2.3-7Joe Orton <jorton@redhat.com> 5.2.3-6Joe Orton <jorton@redhat.com> 5.2.3-5Joe Orton <jorton@redhat.com> 5.2.3-4Joe Orton <jorton@redhat.com> 5.2.3-3Joe Orton <jorton@redhat.com> 5.2.3-2Joe Orton <jorton@redhat.com> 5.2.2-4Joe Orton <jorton@redhat.com> 5.2.2-3Joe Orton <jorton@redhat.com> 5.2.2-2Joe Orton <jorton@redhat.com> 5.2.1-5Joe Orton <jorton@redhat.com> 5.2.1-4Joe Orton <jorton@redhat.com> 5.2.1-3Joe Orton <jorton@redhat.com> 5.2.1-2Joe Orton <jorton@redhat.com> 5.2.0-10Joe Orton <jorton@redhat.com> 5.2.0-9Joe Orton <jorton@redhat.com> 5.2.0-8Joe Orton <jorton@redhat.com> 5.2.0-7Joe Orton <jorton@redhat.com> 5.2.0-6Joe Orton <jorton@redhat.com> 5.2.0-5Joe Orton <jorton@redhat.com> 5.2.0-4Joe Orton <jorton@redhat.com> 5.2.0-3Joseph Orton <jorton@redhat.com> 5.1.6-4Joe Orton <jorton@redhat.com> 5.1.6-3Joe Orton <jorton@redhat.com> 5.1.6-2Jesse Keating <jkeating@redhat.com> - 5.1.4-8.1Joe Orton <jorton@redhat.com> 5.1.4-8Joe Orton <jorton@redhat.com> 5.1.4-7Joe Orton <jorton@redhat.com> 5.1.4-6Radek Vokal <rvokal@redhat.com> 5.1.4-5.1Joe Orton <jorton@redhat.�x��������������Y�������X�3c\?cd23����������
k�46b0�${����������������
k�j�l�
�for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files noreplace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild�x�������������I�������X�1f�?3174���������b�5da7�$r����������������
b�c�a�
�22e002ccfd334b73bc33e3e9fb605b8642465c963543d8778994fc4d386a8e5a816e8edea8408356fa2aac52e57eb6b8bc3833a2cd27e77f11ef143b3ed720f5f88ab8689ba48798dc245207177b8b395ab4531e57a060a356ba5cbdaa119602f2169ec515275b28c7ac458478d9909dbec81e08a2cecacc47dda4576a2638072d6d8ef013bb82436570c81044eca7a45e16fef71e625c4575c44abcf6eb4ed592960b658d4e300c91c1c3113122ef4e9dd7e35b913e2fd7c50ff207c0d9af288836ead1724e473a587efab68d93c53fd37dc0c658be293f598a54f0a475486de47ce7c313265a340fec53ef21de6aed96e77134a7a32244fe250db9995068fe74dce0e23fd70c12b03fd94751d98b773be8f64896b6ace0878969b499bcd9e3d243fd927cac1f3b88d18e37c28c1ac2e3fab0b96748c99ba6d1374f1e6ab20e461b26bf312a432a723941a6efd284f29713bd9bc353ce5e977daec97dfda37807b5a99f9016851a0c9f9360745e155f3b0a01447ed27e92629ffd7f47e41d5f092d5c71114a1fd93d78a0641f003959688aa45b5fce2f7bb9a22a323790c35f74bc3c2572dbdb0c52a80e0fb53e60e9777c8c2927c39939c8a4f50d12f0e6d7c544b83c25a5be14681e2479d13e2de9ff15c79280d45ff424362a48bd0f384adb9d6ac4f691422a0b42395c80a8a65f90ffb2e67f50e70f1e459596b02bb508feee4a880f4529a335e8d531051fe632a906cd548325116e6e35bb0575d58ae6392ee9f48c56ee48f90b0ea6be4f69ef4803d137e9a46b0e64f1c41a95e83bade0823678e9caeacd7c25f6f0681760f8adeaf6ddaa94b9aa46d17f9d183a3ec7f61e5766055b6c467132e8552a601d33b863d8feb62f24b1387307edb48ac3268a5c5d62fcdbd46e602034e8bfc15f5f4e26bc9891a18557cbbd13244987d352eefb59ccf5538573850b86b43767c4b21b5702dc62703415c1d01a0f2828738abec57c4fa2a93e7e474c8c3bece11adee4e725397d42ec1301f9ac2d2c596352ac4cd533cb9893b62bb45f0757747050229c75eb03953283421f45fc335d3f9714fb5493d633e5d5360faecaec8a00a46580523cafe4316ce8d2706be2e15d07a6effca444ae52992dd07a8f2f4fdb82dbb4a49ec5a1095d441554746f55cefa572baae235f7329521526a71210c2b382c3b2fd536d232ecdf966c2744d6ce8ac2b891662b88339a99324e8dd105f7b3076830dfe7c8a497fc43d2708a96bbf9323975cbeb742e09bd247817169eb374a58423ee9ac9d9ccd744d09e6f87eb08e00074094623685fcd5c77a0285a09874cd52b8d5bf58a4fe818280a686bc33f0f966a9df022f2d6133438ea020f5a59fa84a50d16e0eae870890522792b32e6631ba88049b83c93f881460155b59696714f183d4a89fd47d8f2eb014bba560ab3d5661e2001e1d77f0329d9059f17e053ccbd0119661d65c4dd33a6734568f352e2a7e1ff5aa098b0919149215cdc6a52ffe710d7ed2ba3d20bac6bf09bcefdbfd5fcc5bb175b599c634e0ac46c468d6d9a0b7279f39e72df40058774707f516bc712d2a2f436300e48a3154436fc67e472d0118a9f15816d2f8ab36bc2eaa9238da03bc0b217b5b921e9a59a321de9db393b4ce6a3af6d436e9fbe0f47b565da2a566f7be0888030440ee6af13fc539ac6dcc1b0478f555eb83d0419232cbcb738a3f856433040833a798174007cf5e3a81b46901a3c9281d3654043f84937eb974a5c9c520c7af403cb2147e663ce1ae5455683214bd2dc2a3d941502521f9bb3344682bbf8ad96b6a23cef405ce993e0863af605b8034c1c4f351ea44a47ae0197624a436f2d388d4b4f7b9f601b7140f8e17a3d643821931c41f74390b46a38f7ef37ee96b860cebe7ec943f6c5fcb87a18ed40e54c0d654fe7b51b201619a2b14bc52f6549863e1ad8464084a5fa910c332dd180f147e3436a246f27507f4fe7d2ef94107227bec20ba67cfd893766e3efce537d2b11a5f87d76d19c4c70fa0d98945cfa8208a32ac267f80cdf296a3a573794feaaa83f012c48ba55783e5b0eee00eadfcc744aec046a363c054fe076aa2d53e662220bd7801ae74cbf306f971ebaeaa1b650dd6e05db575ad37f77dfddb8da9b52ad06966c916e8d2a777e3da039dc88c7af462106f3b4645fd848c93c4b57a3c70c7dc20d56250e8b73d7eafcb0d330099586f670b047e6bacc519dac61f706a284cd2ccccbac21c5aa2ce5ea1d05d04a4b5e5038e5d55c7fab260ab30e2c805275511e17eb590515dcaf02b38d38517b876101e4856f19263029cdfffa9e6a9773914c32e8319ccef143add699897e341aa5a57e52aff07bb07ce14fb817acc3b4e15a8f50286dac56c09392cc79f6d8a61178a90e5d40dbd378cf59bfb08350750d00d957b8ece608e6f7e268ff1796adcc87cc8cac058c014e20bb965634d0a30acd73617034f43c9327c59c58b9e7cb15d7652184ae7c5d08351bfefc3e750424d684b35a8b6e8bfecefee5030625a3dde2199ec8b94df6ec8812fbe69fa07ce7173e3ede8fc85a696ab871c55be78edfe69d4af6cfaac649352e14773a4fee64ab8a96020e4c791ea77e4932e13d76298aa572a13f4b68891349401a160776c2e4f0a2e73ba749c2312d841cb7fbaeea7028671f79871d2efa3a0f052aca097b8389789451e82f944b365f6003c632e4fbf36b43800e315df6ace4ffc2557ac6fe24004d6753c80537e2a59e683568aa50f0e033d6ffc228c9ed26184afe019ad765f4310a503ff1789d244b4329572cf4dc3b6e68ff99cd5fa9�x��������������8�������X�t)�?z.so�vx�P�ompr�$@����������������
P�Q�O�
�compiled code still wrong- ftp uri's should be able to specify being rooted at the root instead of
  where you login via ftp (#84692)- Using newer Japanese codecs (1.4.9). Thanks to
  Peter Bowen <pzb@datastacks.com> for pointing this out.- Rebuild- Release number bumped really high: turning on UCS4 (ABI compatibility
  breakage)- Attempt to look both in /usr/lib64 and /usr/lib/python2.2/site-packages/:
  some work on python-2.2.2-lib64.patch- Rebuild to incorporate the removal of .lib64 and - files.- Fixed bug #82544: Errata removes most tools
- Fixed bug #82435: Python 2.2.2 errata breaks redhat-config-users
- Removed .lib64 and - files that get installed after we fix the multilib
  .py files.- rebuilt- rebuild to update tkinter's tcltk deps
- convert changelog to utf-8- rebuild- pick up OpenSSL cflags and ldflags from pkgconfig if available- urllib2 didn't support non-anonymous ftp.  add support based on how
  urllib did it (#80676, #78168)- Fix bug #79647 (Rebuild of SRPM fails if python isn't installed)
- Added a bunch of missing BuildRequires found while fixing the
  above-mentioned bug- rebuild to fix broken tcltk deps for tkinter2.2.2-3.7.3
- Recompiled for 7.3 (to fix the -lcrypt bug)
- Fix for the spurious error message at the end of the build (build-requires
  gets confused by executable files starting with """"): make the tests
  non-executable.2.2.2-5
- Fixed configuration patch to add -lcrypt when compiling cryptmodule.c

2.2.2-4
- Spec file change from Matt Wilson <msw@redhat.com> to disable linking
  with the C++ compiler.2.2.2-3.*
- Merged patch from Karsten Hopp <karsten@redhat.de> from 2.2.1-17hammer to
  use %{_libdir}
- Added XFree86-libs as BuildRequires (because of tkinter)
- Fixed duplicate listing of plat-linux2
- Fixed exclusion of lib-dynload/japanese
- Added lib64 patch for the japanese codecs
- Use setup magic instead of using tar directly on JapaneseCodecs2.2.2-2
- Fix #76912 (python-tools contains idle, which uses tkinter, but there is no
  requirement of tkinter from python-tools).
- Fix #74013 (rpm is missing the /usr/lib/python2.2/test directory)- builds as python2 require a different libdb
- changed the buildroot name of python to match python2 builds- updated python to 2.2.2 and adjusted the patches accordingly- Fix #53930 (Python-2.2.1-buildroot-bytecode.patch)
- Added BuildPrereq dependency on gcc-c++- security fix for _execvpe- Fix  #71011,#71134, #58157- Resurrect tkinter
- Fix for distutils (#67671)
- Fix #69962- Obsolete tkinter/tkinter2 (#69838)- Doc fixes (#53951) - not on alpha at the momemt- fix pydoc (#68082)- Add db4-devel as a BuildPrereq- automated rebuild- Add Japanese codecs (#66352)- No more tkinter...- Rebuild- Add the email subcomponent (#65301)- Rebuild- rebuild i new enviroment- Use ucs2, not ucs4, to avoid breaking tkinter (#63965)- Make it use db4- 2.2.1 - a bugfix-only release- the same, but in builddirs - this will remove them from the
  docs package, which doesn't look in the buildroot for files.- Get rid of temporary files and .cvsignores included
  in the tarball and make install- Don't own lib-tk in main package, only in tkinter (#62753)- rebuild- rebuild- Add a not to the Distutils obsoletes test (doh!)- Rebuild- Only obsolete Distutils when built as python- Make files in /usr/bin install side by side with python 1.5 when
- Drop explicit requirement of db4
  built as python2- Use version and pybasever macros to make updating easy
- Use _smp_mflags macro- Add db4-devel to BuildPrereq- disable ndbm support, which is db2 in disguise (really interesting things
  can happen when you mix db2 and db4 in a single application)- Obsolete subpackages if necesarry
- provide versioned python2
- build with db4- Alpha toolchain broken. Disable build on alpha.
- New openssl- 2.2 final- 2.2 RC 1
- Don't include the _tkinter module in the main package - it's
  already in the tkiter packace
- Turn off the mpzmodule, something broke in the buildroot- Use -fPIC for OPT as well, in lack of a proper�x��������������'�������X�ig+? pro�����������3atch�$b����������������
�3�3�3
�repodata_lookup_num now works like the other lookup_num functions
- new functions:
  * selection_make_matchsolvable
  * selection_make_matchsolvablelist
  * pool_whatmatchessolvable
  * repodata_search_arrayelement
  * repodata_lookup_kv_uninternalized
  * repodata_search_uninternalized
  * repodata_translate_dir
- new repowriter interface to write solv files allowing better
  control over what gets written
- support for filtered file lists with a custom filter
- dropped support of (since a long time unused) REPOKEY_TYPE_U32
- selected bug fixes:
  * fix nasty off-by-one error in repo_write
  * do not autouninstall packages because of forcebest updates
  * fixed a couple of null pointer derefs and potential memory
    leaks
  * made disfavoring recommended packages work if strong recommends
    is enabled
  * no longer disable infarch rules when they don't conflict with
    the job
  * repo_add_rpmdb: do not copy bad solvables from the old solv file
  * fix cleandeps updates not updating all packages
- new features:
  * support rpm's new '^' version separator
  * support set/get_considered_list in bindings
  * new experimental SOLVER_FLAG_ONLY_NAMESPACE_RECOMMENDED flag
  * do favor evaluation before pruning allowing to (dis)favor
    specific package versions
  * bindings: support pool.matchsolvable(), pool.whatmatchessolvable()
    pool.best_solvables() and selection.matchsolvable()
  * experimental DISTTYPE_CONDA and REL_CONDA support- Backport patch to add support for modular updateinfoxml data- Backport patches for: Install of update of nss.x86_64 adds i686 into transaction (RhBug:1663136)- Backport patch: Fix memory leaks, memory access, not used values- Update to 0.6.35
- Backport patch: Make sure that targeted updates don't do reinstalls- Conditionalize the python2 subpackage- Update to 0.6.34- Update to 0.6.33- Update to 0.6.32- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Update to 0.6.31- Use librpm to access rpm headers- Use librpm to access DB- Switch to %ldconfig_scriptlets- Disable librpm from accessing DB- Allow disabling python2 bindings- Switch to ninja-build- Update to latest git version
- Switch to use librpm for accessing headers / rpmdb- Update to latest snapshot- Better error message on DB_VERSION_MISMATCH errors- Update to 0.6.30- Band-aid for DB_VERSION_MISMATCH errors on glibc updates- Update to 0.6.29- Rebuilt after RPM update (№ 3)- Rebuilt for RPM soname bump- Rebuilt for RPM soname bump- Add support for REL_WITHOUT- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Backport patch for fixing yumobs- Update to 0.6.28- Backport few fixes for bindings- Update to 0.6.27- Update to latest snapshot- Enable AppData support (#1427171)- Update to latest git
- Switch to libxml2- Use %{__python3} as PYTHON3_EXECUTABLE- Update to 0.6.26- Update to 0.6.25- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.4- Rebuild for Python 3.6- Use upstream python build options- Update to 0.6.24- Typo fixes in spec: s/MULTI_SYMANTICS/MULTI_SEMANTICS/- Trivial fixes in spec- Enable suserepo on Fedora to enable making openSUSE containers with Zypper- Enable helixrepo on Fedora- Backport patch to fix dnf --debugsolver crash (RHBZ #1361831)- Update to 0.6.23- Backport couple of patches from upstream- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Update to 0.6.22
- Backport patch which will help to not autoremove needed packages
  (RHBZ #1227066, #1284349)- Enable deb/arch support for non-rhel distros- Modify enabled/disabled features- Update to 0.6.21- Backport patch to fix crashing on reading some repos (RHBZ #1318662)
- Backport patch to fix installing multilib packages with weak deps
  (RHBZ #1325471)- Update to 0.6.20- Reorganize spec file
- Enable helixrepo feature
- enable appdata feature- Apply 9 patches from upstream- Update to 0.6.19- Explicitly add rubypick and ruubyge�x�������������p�������X�3?������������@:������5�$�����������������
55
1x�3
!pQ�p�)�Tξ7��]�mtZ`g�
'
	�]�mtZ`�(�ʼNo�C
;BXfޠ@�+g
��+{���K��*��g��3�4�=�>9Ց��M!�R���Qx{��>���?mBu��d#p�6�"�.ž,j;#7$p�K��p��F,4�X���.��I����3e
T~%4���`ˬ�/� ��%�q�nx��vu���5�^0��s�CY-�ch�_.��cr(Zah�R3KQ�e肆.��`4�J����wy䄨o��&vQ��E%(�Cay����*
���ގ���}�Ym�)>��A;{�+Bl~�?�P)n[:E�Bx9�D���RzW=�!�ⳘSP�7��g"�n�~�?�}w��OL?�Sqle�
RN=�a��C�s+��Э�娩<ݞ��9(�-uT�ٱ�E�B�Ž�b���^���G��'�N��$�Z���b�.<�u�\5V����i�p��hh{m
�"H+�6{r��f��ÎZ+��ġ��;z�"�g�H
[�څ)(�%*�y�
��y���'��ڿ�Se�3
!pQ�p�)�Tξ7��]�mtZ`g�
'
	�]�mtZ`;��|�����	�ʳil��ۢ��T8C�ΆFx��=�����_��_F���;��j}�΋���
��IV�h4����[��^������?��:.Ž�+{(�zE
���0����-��톧u���Q����U�l;x6�?@�_��{�a"\�ol��E��RC��/��$����{���h��d�C��53�ހ<�B�d��^+��wGE׫k�����՜ݩպ�Ɇ�.��@�鈺���5��p:M�H��}�dhk�^o;
�eHº^-Crz�GAf��sq�jܜ��wcH��4����`�R����>�h��5ԆZ�%�e��J/�]���hEN�%N��'�8w�+��r��[��T>����o&8VM���<NJޏ��n�7��s�b�E�=��Il��h�
ښ�mώ��-�藘���O�IU:�< �GT��I��Öa�acW-n[NS3��,Ⱦ�w�a��s�<
p�����	�����$�s�tyt~4*Ip3316e76b87690fe43020d9f79ee4f8c2ff3e8767db95a6acd05c12adf3ad5b7ff9349ce26738c0f4e70143149e4eba68267b3b5eg�<� g�2kages/setuptools-59.6.0.dist-info//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_distutils//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_distutils/command//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_vendor//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_vendor/more_itertools//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/_vendor/packaging//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/command//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/setuptools/extern//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel-0.37.1.dist-info//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel/cli//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel/vendored//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/wheel/vendored/packaging//opt/lc/lwdbadmin/virtualenv/lib64//opt/lc/lwdbadmin/virtualenv/lib64/python3.6//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/PyYAML-6.0.1.dist-info//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/_yaml//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cffi-1.15.1.dist-info//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cffi//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography-40.0.2.dist-info//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/backends//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/backends/openssl//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/bindings//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/bindings/_rust//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/bindings/_rust/openssl//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/bindings/openssl//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/asymmetric//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/ciphers//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/kdf//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/cryptography/hazmat/primitives/serial�x���������������������X��	?+y�R������75�$'����������������
756585
�s__init__.py_distutils.py_sysconfig.pybase.pymain.pymetadata__init__.pybase.pypkg_resources.pymodels__init__.pycandidate.pydirect_url.pyformat_control.pyindex.pylink.pyscheme.pysearch_scope.pyselection_prefs.pytarget_python.pywheel.pynetwork__init__.pyauth.pycache.pydownload.pylazy_wheel.pysession.pyutils.pyxmlrpc.pyoperations__init__.pybuild__init__.pymetadata.pymetadata_editable.pymetadata_legacy.pywheel.pywheel_editable.pywheel_legacy.pycheck.pyfreeze.pyinstall__init__.pyeditable_legacy.pylegacy.pywheel.pyprepare.pypyproject.pyreq__init__.pyconstructors.pyreq_file.pyreq_install.pyreq_set.pyreq_tracker.pyreq_uninstall.pyresolution__init__.pybase.pylegacy__init__.pyresolver.pyresolvelib__init__.pybase.pycandidates.pyfactory.pyfound_candidates.pyprovider.pyreporter.pyrequirements.pyresolver.pyself_outdated_check.pyutils__init__.py_log.pyappdirs.pycompat.pycompatibility_tags.pydatetime.pydeprecation.pydirect_url_helpers.pydistutils_args.pyegg_link.pyencoding.pyentrypoints.pyfilesystem.pyfiletypes.pyglibc.pyhashes.pyinject_securetransport.pylogging.pymisc.pymodels.pypackaging.pyparallel.pypkg_resources.pysetuptools_build.pysubprocess.pytemp_dir.pyunpacking.pyurls.pyvirtualenv.pywheel.pyvcs__init__.pybazaar.pygit.pymercurial.pysubversion.pyversioncontrol.pywheel_builder.py_vendor__init__.pycachecontrol__init__.py_cmd.pyadapter.pycache.pycaches__init__.pyfile_cache.pyredis_cache.pycompat.pycontroller.pyfilewrapper.pyheuristics.pyserialize.pywrapper.pycertifi__init__.py__main__.pycacert.pemcore.pychardet__init__.pybig5freq.pybig5prober.pychardistribution.pycharsetgroupprober.pycharsetprober.pycli__init__.pychardetect.pycodingstatemachine.pycompat.pycp949prober.pyenums.pyescprober.pyescsm.pyeucjpprober.pyeuckrfreq.pyeuckrprober.pyeuctwfreq.pyeuctwprober.pygb2312freq.pygb2312prober.pyhebrewprober.pyjisfreq.pyjpcntx.pylangbulgarianmodel.pylanggreekmodel.pylanghebrewmodel.pylanghungarianmodel.pylangrussianmodel.pylangthaimodel.pylangturkishmodel.pylatin1prober.pymbcharsetprober.pymbcsgroupprober.pymbcssm.pymetadata__init__.pylanguages.pysbcharsetprober.pysbcsgroupprober.pysjisprober.pyuniversaldetector.pyutf8prober.pyversion.pycolorama__init__.pyansi.pyansitowin32.pyinitialise.pywin32.pywinterm.pydistlib__init__.py_backport__init__.pymisc.pyshutil.pysysconfig.cfgsysconfig.pytarfile.pycompat.pydatabase.pyindex.pylocators.pymanifest.pymarkers.pymetadata.pyresources.pyscripts.pyt32.exet64-arm.exet64.exeutil.pyversion.pyw32.exew64-arm.exew64.exewheel.pydistro.pyhtml5lib__init__.py_ihatexml.py_inputstream.py_tokenizer.py_trie__init__.py_base.pypy.py_utils.pyconstants.pyfilters__init__.pyalphabeticalattributes.pybase.pyinject_meta_charset.pylint.pyoptionaltags.pysanitizer.pywhitespace.pyhtml5parser.pyserializer.pytreeadapters__init__.pygenshi.pysax.pytreebuilders__init__.pybase.pydom.pyetree.pyetree_lxml.pytreewalkers__init__.pybase.pydom.pyetree.pyetree_lxml.pygenshi.pyidna__init__.pycodec.pycompat.pycore.pyidnadata.pyintranges.pypackage_data.pyuts46data.pymsgpack__init__.py_version.pyexceptions.pyext.pyfallback.pypackaging__about__.py__init__.py_manylinux.py_musllinux.py_structures.pymarkers.pyrequirements.pyspecifiers.pytags.pyutils.pyversion.pypep517__init__.pybuild.pycheck.pycolorlog.pycompat.pydirtools.pyenvbuild.pyin_process__init__.py_in_process.pymeta.pywrappers.pypkg_resources__init__.pypy31compat.pyplatformdirs__init__.py__main__.pyandroid.pyapi.pymacos.pyunix.pyversion.pywindows.pyprogress__init__.pybar.pycolors.pycounter.pyspinner.pypyparsing.pyrequests__init__.py__version__.py_internal_utils.pyadapters.pyapi.pyauth.pycerts.pycompat.pycookies.pyexceptions.pyhelp.pyhooks.pymodels.pypackages.pysessions.pystatus_codes.pystructures.pyutils.pyresolvelib__init__.pycompat__�x�������������P��������X�d2�?1b8d��X��H3ac�$:����������������
�H�H�H
�util.5.gzconsole.apps.5.gzconsole.handlers.5.gzconsole.perms.5.gzenvironment.5.gzfaillock.conf.5.gzfingerprint-auth.5.gzgroup.conf.5.gzlimits.conf.5.gznamespace.conf.5.gzpam.conf.5.gzpam.d.5.gzpam_env.conf.5.gzpassword-auth.5.gzpostlogin.5.gzpwhistory.conf.5.gzsepermit.conf.5.gzsmartcard-auth.5.gzsystem-auth.5.gztime.conf.5.gzPAM.8.gzfaillock.8.gzmkhomedir_helper.8.gzpam.8.gzpam_access.8.gzpam_console.8.gzpam_console_apply.8.gzpam_cracklib.8.gzpam_debug.8.gzpam_deny.8.gzpam_echo.8.gzpam_env.8.gzpam_exec.8.gzpam_faildelay.8.gzpam_faillock.8.gzpam_filter.8.gzpam_ftp.8.gzpam_group.8.gzpam_issue.8.gzpam_keyinit.8.gzpam_lastlog.8.gzpam_limits.8.gzpam_listfile.8.gzpam_localuser.8.gzpam_loginuid.8.gzpam_mail.8.gzpam_mkhomedir.8.gzpam_motd.8.gzpam_namespace.8.gzpam_nologin.8.gzpam_permit.8.gzpam_postgresok.8.gzpam_pwhistory.8.gzpam_rhosts.8.gzpam_rootok.8.gzpam_securetty.8.gzpam_selinux.8.gzpam_sepermit.8.gzpam_shells.8.gzpam_succeed_if.8.gzpam_time.8.gzpam_timestamp.8.gzpam_timestamp_check.8.gzpam_tty_audit.8.gzpam_umask.8.gzpam_unix.8.gzpam_userdb.8.gzpam_usertype.8.gzpam_warn.8.gzpam_wheel.8.gzpam_xauth.8.gzpwhistory_helper.8.gzunix_chkpwd.8.gzunix_update.8.gzconsolefaillocksepermit/etc//etc/pam.d//etc/security//run//usr/lib//usr/lib/.build-id//usr/lib/.build-id/01//usr/lib/.build-id/03//usr/lib/.build-id/15//usr/lib/.build-id/1c//usr/lib/.build-id/21//usr/lib/.build-id/27//usr/lib/.build-id/2c//usr/lib/.build-id/33//usr/lib/.build-id/39//usr/lib/.build-id/42//usr/lib/.build-id/46//usr/lib/.build-id/4a//usr/lib/.build-id/4c//usr/lib/.build-id/51//usr/lib/.build-id/60//usr/lib/.build-id/64//usr/lib/.build-id/65//usr/lib/.build-id/68//usr/lib/.build-id/6b//usr/lib/.build-id/6e//usr/lib/.build-id/72//usr/lib/.build-id/7a//usr/lib/.build-id/7b//usr/lib/.build-id/82//usr/lib/.build-id/85//usr/lib/.build-id/88//usr/lib/.build-id/8d//usr/lib/.build-id/96//usr/lib/.build-id/99//usr/lib/.build-id/9f//usr/lib/.build-id/a2//usr/lib/.build-id/a5//usr/lib/.build-id/aa//usr/lib/.build-id/b0//usr/lib/.build-id/b1//usr/lib/.build-id/b2//usr/lib/.build-id/b4//usr/lib/.build-id/bf//usr/lib/.build-id/c6//usr/lib/.build-id/ca//usr/lib/.build-id/cc//usr/lib/.build-id/cd//usr/lib/.build-id/ce//usr/lib/.build-id/d7//usr/lib/.build-id/d9//usr/lib/.build-id/de//usr/lib/.build-id/df//usr/lib/.build-id/e0//usr/lib/.build-id/ed//usr/lib/.build-id/f2//usr/lib/.build-id/f6//usr/lib/.build-id/f8//usr/lib/.build-id/fe//usr/lib/tmpfiles.d//usr/lib64//usr/lib64/security//usr/lib64/security/pam_filter//usr/sbin//usr/share/doc//usr/share/doc/pam//usr/share/doc/pam/html//usr/share/doc/pam/txts//usr/share/licenses//usr/share/licenses/pam//usr/share/locale/af/LC_MESSAGES//usr/share/locale/am/LC_MESSAGES//usr/share/locale/anp/LC_MESSAGES//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/as/LC_MESSAGES//usr/share/locale/ast/LC_MESSAGES//usr/share/locale/bal/LC_MESSAGES//usr/share/locale/be/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/bo/LC_MESSAGES//usr/share/locale/br/LC_MESSAGES//usr/share/locale/brx/LC_MESSAGES//usr/share/locale/bs/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/cy/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/de_CH/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_GB/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fa/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/shar�x��������������������X�52?a55aоؿ�V1640�$.����������������
�V�V�V
�f2d09511b49dc918c725cd7b6b149441d3c67dbaf8ff43d6df436f9200c72c235c6b597b6751550cb3de3efd190e496f244b23a74ac6d2ec825064053934485832818738200a72dfc4c723186efdbfd82d04690ee48dfe9c6fc8035b0f86d7d0c0a9379fc44b800aed6b66414b5b2b99ca42f4c6799c9b7a27143d23f8dc1ece5fdb2afb11bb8dcc0ce7a07cae606ac18f7010776a83b484769ee1280b81ec8852b6f5bb952073aa04f6589920a3805a187b7a473578d9d23959eda250c9e76391ad07e245f4df95e0507a40f45f877de036eae1c3105a7529e096caa478d6df9644d3e54fb31004f2179a2f0fe99e3790f9b0c409983b1988a08aef42bc9ce1327bd8ffc465c11c2ba4daf523b2c340ca20a463a38694744f2f7f022bbda61825b9f6c3c29846e61574de671eca3b5cf375c4a4232eb23c68f64b25f836b34a8b180467ff0f4ad5a5d78928b9dc77404079871ddd3e1bf25c5045c3ae5dbbfeade9145cb0a58a5e2f8a61109fcb4a2b8071cb63574fe0f41339f3063da0199e80637b8cef7ed041ec84358a46f74b5347668178a986da92c986fc43e6b77b2b9af76ea9a18194995493e89a73619c17c7dc97e80c7c8a9c283ca08a62c5db0a7304725805967583c8890db0a1345504db8df4ab2552691d6e00736f3e55fe7ec031877e714af4b07c373ce2b3b3c803733f5e3d980ff02a81bdf66e4eae7366f9303d5349a4367fca988b0673c4fbf9f3b8bf4f8993c16c2b6be3faa296caa3db48b82cb60ff01d992787f860c84dbea6e295fdb94dff2e9819b7e8d230282f2569d927a85c12b3811996a70251d766cd9b4d958fd679a5fdc203ea2ec78c13e656c82efa34695c021611c6d17eb13deebe0bfc318243bb59764ba2f5c5ce2d593cad9952882e68876bd92de64321c5acde40046673ceac3649db2c6fbb72aef2a8c4ef5229163a91f7fbd97c095e467578dacce5545d167d244abf7ee88a9b569a29e5b51e260263a6554dbedbf521833215b85422386c5032c0366e0cd8d2667de4ffa8ed44abbecc49159f94d74fabb6c1324b1f2cfce313f25c68584821b1748b9ad59715b08886d8f61eed71912d3840dddc368e827edfbdef40aa155454092a72f99d56c0502ec63fd5afa4e85b86c9502f8ad4f1b087afd40967d24a3b01f8046f1a2407d632f8720b505be1e25c3bd6c8225c5b1ddbe1c18ea7b33f88fc44a1d38e85943a5c225747fa9733fd589bc3af7ec8b3d23a156a62a06d15a39c37fa7d14d4a5eab4e2f6698749979480905bfbcff95874aa408e98772338ec9a8c876b02e8e0f6d24f935a057fafb5819e17567c88f49d62108e1e83153931be3ecfe8ea81f68090415a1754f1fff9ab140d061cdd9943ae16c2de43ad796959be96820edb1be9d1818cd80c5e270b8093538d3204e535abdee86b968169c0c16b52732a593ca9c662f75c2ce1e30e513fc3f432235f5818a65bd57fec9e3e193216f13b4c28c3c49f4e593023c55b487e0f1b59ed62b3319f717e3e76420dc2d72b1a8d74a8e4aedb469e6602d10e01b46576a08c5fbac777cba951f24cc1596bf75c4e4fe27b21bfc81a11a054b95cf7bff2227105470aa806f93443182ce7a4accdc9286b9d85475f7380e779e48abf9188b3e553928d61bda6293dd3e0e20c58a64273e1447a7f93af2035754867de8bd129d14cb4f19f153cca52c88be3f71601501cbc9fc28d389ae7789bf3cf8394b7b3a68264ed812f2ccd855001705753254698c0a2991d889e9d8a3cfec34704b040b1020f23789fdfa08c4cb1b238c7f0887332e525f59a93c79a13174364f1eccd889200c11d1114c6f075dde2e76c1fe5e693a1f3721757814b4ff11b2644eb756e2316f6bb30011de182ea92f24ce01e04b5322eecb692c5595717ee187c9b55f912e86d13c243ed99d2e8c7a95a49286b27d55fb97196052c3c0e9232f08a8ce3c5401bc9c0cbeebab451a02bfae5350805ccbfb14970b97e975cbfe7cafdd0a494aa45027623a33a91f1e92902ac372a5b6bcddd24b4d8ddc2d99f894f18e6573b8632a0bb1c165fd0ddf2cf39487e7c1f8f3e61a3b146c3e247a222f4470598cda72dfbdc731f49f888a3be75caa92d97d57e5ca0bfd4da5a30ba503f56fef24d83953013ccd27d6edd08b036909c3338c3843274a84bca865683c7259f97ebd5084829ec9ec82c3c1b5e1a7c29f07562c88f855a1622f663f973f01fc95ecbcfd8c3c883d6e767abd1d42466019c1874ece28662df31d4a3b8feec6d8cb72a43a4eeaf128ce49dfb3bec5ecc95b036cd0d21cb5de59fa0efa8ff94918acc401e9ad5e29c590ea268dc3fdef449cee9b912caf2c7dd863799771756957c648c524c332104c9aad9b7ffe86c441ca4971bb9a1e0e2a1cd5a634318afd9b5e87931f3ae5791e18da1f6314e9479a39f45396badb3ddd4f1fcff338cb8fec1de0d52a660c1a91f884508a5576c6b97f740fdb9ab81ef8aa7cfa4b3272986272150fd445b8effeff986c2097cd88fba880fed1bb856258f00fa66f930bf2cf2fff3b8fb49f675a31a800f9ade01644b61ff2116601ab8e5c2a835f75ee67b431fd484cfd30fedc3f875237c18deedd56dca7b7884f1353bfb24f8578da7870a803374d5e3f98ea6b1ba3277d2d825fb0109fb612922b4f18c09998c73524bed6386ecc6a05d7c17e241956a6ce9af81ded15122c056017a5972bc9de433d7d3f0c5d977df7e45018a08afdd538836d96b7a7f27e4a45e21e0bc21f8ad30fb293e9eda21b0dc502dab28348a3d00eeae320de282214de925766f481db�x�������������@�������X�pp�	?for
�������������5n (#�$����������������
555
�1020a955f9fe28f74b0e76731de8706fa349769ea7c938653393065e684106b9184c2531daa12158dcabb8bce3e03386640407dfd866d9f27fc0377dd2894d3a6a12efecf8d17a5486780aa774b5b6c0e70b56932d8864f35df1eb7a18bb759b3a69ac3d8f27e679c81b94ab30b3b56e9cd138219b1ba94a1fa3606d5a76a1433dc9199315871b11b12df226f890a38e66e63191e1adbfb11a66e6861151b33fca7ea7ffef3fe2a117ee12c68ed6553617f0d7fd2f0590257c25c484959a3b7373ceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f150823a7361c2b1581028bc623b9da2bd24997abcaa4781ace6ad444a37944f8dae13e359cbc512a25de2039f8906a6f22977e3fc0f34ac5ff2e6f2608db0626eed7a39a5bf08ef1509cd872e490d806dafec403c5ba475e0c1b60be5a7b0892b8fa7b0c04b9e8a8d42d977874ef4f5ee7f1d6542603afc82582b7459534b0a53fdae44c526b5b39e3348f340ff57a9267e525f4ebbf3a4bc939607c2c90cbd5633cceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f1508e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855efdf3284f21fe9e3078bb4793a06f7049e402c9d0877c23012e3925360c5969d997c160dfb4d2cc29fc15a8a156184feeb8166f1922225042e12e47b2b08b9979e7142bb1acf32000bac80f14a8cbe1fa663e16e1463ad03fae2f5689caad297b888381c90e064ae78d855d54e5de390f0cd6e494d81bf118fa0de65e7ffa12fef579a630ae5b37e0727a8336e69988a8b622a13cd15333fb6a6095c3e677f7b1641c1829c716fefe077aaf51639cd85f30ecc0518c97a17289e9a6e28df705534ae72a9ee3d4a013164e085544513e417f4415d82b884c62b6ed64a8d8c5a0fa05baf8cbb18135ed5ebb2f5747793a3e61e3d937ded12a93ae1845f008ac0b7a3a86e78749cdd5599fbf768f5e7a864a11ac6a875f33957280cd5674d0a83ea6b5a4106fbc62c3899d4ac3ae3fe2d4fa1e6453c180e8632f091601b90b39fbb8a827c21595bd8ad6a2cec51fad5e479ef6551185857cf420ccef530a6a0ed8643d4e7cad7ee0b96762528c1156546b447582c5cbbaee90d21bd389a8bc7740a0835d3b85af6503f28cce95961fd4a0f3890768f7e5ff21a60e894732250c2b085af30a3072563cfcf6a8334733e06eaa2b7ef38e7ceec50fb274eb73c7810c22dae89f18a274f1a0fb49f0730f3784532b2ce0d154bf478bf17d57ff1e6159c4c5863c6d3a72de349e58991bd09b878a3e03db24d9198aa3bc8ce5eec516985b0414751a5096eabfc880acbdc702d733b5666618e157d358537ac4b2b43121d55cd478ec2c4b720a1ef9d3a3a8ccf1cf2977b61e4fb3f5c164145dc1323d653a7d82f73a5bfc60c44db33b4a3c357a8ed601891229c42b8daa102f9aec29ee9d208d747b8f7eb1253e5cb3685e614fdd7ce7e99c57f35fc3a83cd3682a1a9d39131bf235551dcde64182e0c6bda504d2a18f50d54442acdcac787490fab08be6ab13cbcbb2d8c183e02bd64ad717e6c1993d6a06d9cbec5a64f8d561dfc6b4592b113fb2e390a74335f0291d6a03733fb491382c4daf9d0b66df27c6c834a71a7896660381ac11af00c552975effed4695de39167b0c347505b4e58550271218028e80fa7e80593c1000631e6df3364b90986c17f651b676f774fb83edb78ef11554ebaf1ada0f11d162f1236799daa5090ae10b157e909b1dc2d75c0a75c6481c73a40391c80730eb809f9531699c004adb1106b9c64a7ff2c634b9ec92283d555575e3e4cb08daa1fe37bba789043256483e2829ff45d8e2ca25269144b951d359d4dbef605cae6dad03f779e7f857eb241b7219ebfd745d0365ecf2e02954a70a1d7d7b9cd02a89cd3fb8f6e5cff1aeed169bbc16585f23e3d7fe0f2f41cb1b059880451734e7442ab8e29c0af3abd8add72eca1879b2ca646462fff894239111b3c717a533bd08862c2d542231b9d8a73f8d80e071764c63380a5cc6c120cd4d800624d96330efd8601c6ba5cc23d05125ee5a3f3f9e7ff7c3ba8364cd9c464b02cf61433b8cffcc703fb09cce03df3b0fd27f8d4a41c5a78774980588874a1c1125f1a5e7a95b91074356ecdcfb97260cc2bed709f90c66f50e45a491a1eaea4b7a8170608cd8ade614d358b03378234e2a807e374a46612a9e86b962fdc55180fc19be18b92bb7a60802fc545cb590436e99b964af3db4f92c2148e8140e6dfe8a00b1adc06c7e029dd46b915f71f69131758e93fc1cae6ee7e606082ddfb04ac684059d1b3b8eed679ad05ffc6fd7cac942f53e861eb76ef73a80283f8d833748b3ec3f85c7abfd4f35cb38295539632518399bbf71b9faaf6e3bf4b5f27e24599f65fc591eb55fe245e74054ef64dd9959277963f2f5c9ee2afd918be9b7e25e4d979f87c6be142db665e0525c555bb817174868882e141925a3694eeb854787d0853f754324d77fa504037d73346e27a75b1bbe949fbc6e437e829fcdf4b21cc005db1833770540e58a4481f77588f4f1efdccbe427861aa5facf6495c8f8adbf4f3e41a961dbf064e5d88027d18003f77e6bdde4a28b90a1d006d0a91fa0b3f47499d1cb0dfca3ed39cbd2f531982dbed9346b42000995b635d6d4a4eedc3c64fd4358c609f0c89b001b1af08304d848efd4f29e1a56100814d972d034a4c92b28d5ab15da3e7b65070754a931b5c7061fe8654228c6f2449c793c790f538d92d98f25df279d44e1f�x���������������������X�> �?6.28��H��9gine�$A����������������
�9�9�9
�������������������������������������������������������������libqdbm.so.14()(64bit)qdbmqdbm(x86-64)@@@@@@@@@@@







@libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)liblzo2.so.2()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libqdbm.so.14()(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3_!d�_	��^�@^2�@^!��]:�@\��\U�@\E�@[I�[3|@['��Z}�@ZL�Y�@Yy�Y3�@X���Xv@W7@V�=@V�<@U���Un�@UD�@T��@S��@S�@S��@S��@S^B�Q�B@Q�@QE�@Q�P
��O��@OL��O2c�O��M�A�Lw��LG�K2@Jj�I��@G�h�G���G>�G-�@F�%@F��Fs�Fo�E�E��@E�4@E�@Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-42Jiri Vanek <jvanek@redhat.com> - 1.8.78-41Jitka Plesnikova <jplesnik@redhat.com> - 1.8.78-40Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-39Mamoru TASAKA <mtasaka@fedoraproject.org> - 1.8.78-38Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-37Jitka Plesnikova <jplesnik@redhat.com> - 1.8.78-36Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-35Mamoru TASAKA <mtasaka@fedoraproject.org> - 1.8.78-34Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-33Jitka Plesnikova <jplesnik@redhat.com> - 1.8.78-32Mamoru TASAKA <mtasaka@fedoraproject.org> - 1.8.78-31Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-30Mamoru TASAKA <mtasaka@fedoraproject.org> - 1.8.78-29Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-28Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-27Jitka Plesnikova <jplesnik@redhat.com> - 1.8.78-26Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-25Mamoru TASAKA <mtasaka@fedoraproject.org> - 1.8.78-24Jitka Plesnikova <jplesnik@redhat.com> - 1.8.78-23Fedora Release Engineering <releng@fedoraproject.org> - 1.8.78-22Mamoru TASAKA <mtasaka@fedoraproject.org> - 1.8.78-21Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.8.78-20Jitka Plesnikova <jplesnik@redhat.com> - 1.8.78-19Kalev Lember <kalevlember@gmail.com> - 1.8.78-18Mamoru TASAKA <mtasaka@fedoraproject.org> - 1.8.78-17Jitka Plesnikova <jplesnik@redhat.com> - 1.8.78-16Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.8.78-15Yaakov Selkowitz <yselkowi@redhat.com> - 1.8.78-14Mamoru TASAKA <mtasaka@fedoraproject.org> - 1.8.78-13Vít Ondruch <vondruch@redhat.com> - 1.8.78-12Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.8.78-11Petr Pisar <ppisar@redhat.com> - 1.8.78-10Mamour TASAKA <mtasaka@fedoraproject.org> - 1.8.78-9Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.8.78-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.8.78-7Petr Pisar <ppisar@redhat.com> - 1.8.78-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.8.78-5Bohuslav Kabrda <bkabrda@redhat.com> - 1.8.78-4Mamoru Tasaka <mtasaka@fedoraproject.org> - 1.8.78-3Marcela Mašláňová <mmaslano@redhat.com> - 1.8.78-2Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.78-1Marcela Maslanova <mmaslano@redhat.com> - 1.8.77-7Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.77-6Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.77-5Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.77-4Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.77-3Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp>Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.77-1Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.76-1Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.75-3.dist.2Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.75-3.dist.1Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.75-3Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.75-1Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.74-3Mamoru Tasaka <mtasaka@ioa.s.u-tokyo.ac.jp> - 1.8.74-2Mamoru Tasaka <mtasaka@ioa.s.u-tok�x�������������0��������X�"?���������p���������$'����������������
��
�J?4d
�
�
�
�	
�	3
��
��
�$
�(
�7
�F
�J
�	Y
�e
�{
��
��	�
��c
���

,H��U(|
8�'9 ':�'B�
G�H�I�X�Y�Z�
[
\]$^�b
dS
eX
f[
l]
txu�v�wTxpy���
��
��
��
�0


D

H
X6

�

�
��

�
g
h
Clibsodium1.0.189.el8The Sodium crypto librarySodium is a new, easy-to-use software library for encryption, decryption,
signatures, password hashing and more. It is a portable, cross-compilable,
installable, packageable fork of NaCl, with a compatible API, and an extended
API to improve usability even further. Its goal is to provide all of the core
operations needed to build higher-level cryptographic tools. The design
choices emphasize security, and "magic constants" have clear rationales.

The same cannot be said of NIST curves, where the specific origins of certain
constants are not described by the standards. And despite the emphasis on
higher security, primitives are faster across-the-board than most
implementations of the NIST standards.i^8�buildvm-x86-26.rdu3.fedoraproject.org��Fedora ProjectFedora ProjectISCFedora ProjectUnspecifiedhttp://libsodium.org/linuxx86_64)��7A�A�����A큤i^8�i^8�i^8�i^8ri^8ri^8�\�k�413c31107f6f27112bec713c17c87a167cfe90eefba9785383fd267ea643254bdea1855c9809f3faf22aa4a1fba20ec8af5a5587f23115012e5b98279cedc4af../../../../usr/lib64/libsodium.so.23.3.0libsodium.so.23.3.0�rootrootrootrootrootrootrootrootrootrootrootrootrootrootlibsodium-1.0.18-9.el8.src.rpm����������������������������libsodiumlibsodium(x86-64)libsodium.so.23()(64bit)@@@@@@@@@@







@ld-linux-x86-64.so.2()(64bit)ld-linux-x86-64.so.2(GLIBC_2.3)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3i^J�]9��\��\T4�\3?@[H�@Z�
�Zz�@Z1@Y��Y�@Y�@Yx�@Yl��XƉ�X��@XN�@W�9�W��V��@V�m@V�=@V,�@U��@U�a@T�7�Tpz�TBV@S��S�@SǺ�S�E�S���Su��R���R��@R��@Q�L�Q�L�Remi Collet <remi@remirepo.net> - 1.0.18-9Fedora Release Engineering <releng@fedoraproject.org> - 1.0.18-2Remi Collet <remi@remirepo.net> - 1.0.18-1Fedora Release Engineering <releng@fedoraproject.org> - 1.0.17-2Remi Collet <remi@remirepo.net> - 1.0.17-1Fedora Release Engineering <releng@fedoraproject.org> - 1.0.16-5Remi Collet <remi@remirepo.net> - 1.0.16-4Fedora Release Engineering <releng@fedoraproject.org> - 1.0.16-3Remi Collet <remi@remirepo.net> - 1.0.16-1Remi Collet <remi@remirepo.net> - 1.0.15-1Remi Collet <remi@remirepo.net> - 1.0.14-1Fedora Release Engineering <releng@fedoraproject.org> - 1.0.13-3Fedora Release Engineering <releng@fedoraproject.org> - 1.0.13-2Remi Collet <remi@fedoraproject.org> - 1.0.13-1Remi Collet <remi@fedoraproject.org> - 1.0.12-1Fedora Rele�x����������������������X�c1h?2f1a�~
��607�$|����������������
������
�593bf26eedcdd360958c7d7a7cd50a5b4bc68a8992d79af2d253583b121af3c776e46eab8b3d35110557f4561e635cce0ad80988a2e73d07f3c907a84a5589868c8315e740eb7d15ec31bd87a8f40b9f40c54247f5b69bd6fdc94721b41c1f04acbb40207688ef9a021f37a9af3e2d15e5771c1da7177a7351e79116d93bc04bf4952d133e9d2599accb26705f673132c363ec16cf372901ba4a1b73c6217bfa28f3dac6b86e604ea63ee77e438aee775ce513a6f282212080bfbe1167dc912a28f3dac6b86e604ea63ee77e438aee775ce513a6f282212080bfbe1167dc912f1b6d81589cd8f901d1ffbf08360a8db79da724efac4eae804233432da91e067f1b6d81589cd8f901d1ffbf08360a8db79da724efac4eae804233432da91e0677c532bbddada3b9784685cddeddc01095be6eba5e0ea532cc40419cebb2ab91b7c532bbddada3b9784685cddeddc01095be6eba5e0ea532cc40419cebb2ab91b56d98ce2aa1787bbfda5327c14222d3f4211247b054fb6068b95dcacc0cbde6b56d98ce2aa1787bbfda5327c14222d3f4211247b054fb6068b95dcacc0cbde6b6e86cc4938133ab4773819f1dda0d5793a476e8663995da9ba457994f1ea44c16e86cc4938133ab4773819f1dda0d5793a476e8663995da9ba457994f1ea44c1de3faf8f16d6dcb90290254840cbe10ba2de07de17fd0b14b88d3e8f4ed57824de3faf8f16d6dcb90290254840cbe10ba2de07de17fd0b14b88d3e8f4ed57824bf9bf412005079f5e435d8855841ab44513b4d6f168daebd250b0a6c92c11d74bf9bf412005079f5e435d8855841ab44513b4d6f168daebd250b0a6c92c11d7460ecbac718d256b0b7419fa955df27c958b4528d005c2f011770c5f91fa71b1960ecbac718d256b0b7419fa955df27c958b4528d005c2f011770c5f91fa71b1953f861f1bc57b180ac47411c3a8eb0526a840fab2c08f8238b2780842c2aa7da53f861f1bc57b180ac47411c3a8eb0526a840fab2c08f8238b2780842c2aa7daf2d6d7164ba39661224bf98f045f9908fa7f11dd3f66231dab1a249a9cca26f5f2d6d7164ba39661224bf98f045f9908fa7f11dd3f66231dab1a249a9cca26f50343c6d26efc5e545424a454054ce898db5c03f34041408ea4b7ff44329857b50343c6d26efc5e545424a454054ce898db5c03f34041408ea4b7ff44329857b523ec879b74e2262b7c75d57b30a9b1f444cb48390eed854044d2341c4601399223ec879b74e2262b7c75d57b30a9b1f444cb48390eed854044d2341c460139922951f45021ea4da225d56d3af71173ba2cdd67931148dcf3ad78afec6bba8d4c2951f45021ea4da225d56d3af71173ba2cdd67931148dcf3ad78afec6bba8d4cd284bf8a6a58a978ecc9d77b1f8fb09f21b388c87a8fe95e9b4d2df5309ce0d3d284bf8a6a58a978ecc9d77b1f8fb09f21b388c87a8fe95e9b4d2df5309ce0d34576ca90db399691d4f3ccbd4ea4ce392b28c32b78355cfe866a19b71801ba914576ca90db399691d4f3ccbd4ea4ce392b28c32b78355cfe866a19b71801ba91d1505d07fa58330eacd44a2c53c3886750204b5918ed75a8285c67eafacba901d1505d07fa58330eacd44a2c53c3886750204b5918ed75a8285c67eafacba901dec652fb631fc70c0517a3b99bd6269ec4827faccc5ec5cc26fdfed5ab783cd0dec652fb631fc70c0517a3b99bd6269ec4827faccc5ec5cc26fdfed5ab783cd0c17ca1d64151153165840d8402b55022e0064ff88d5bf42b0562d7e9cb3c617cc17ca1d64151153165840d8402b55022e0064ff88d5bf42b0562d7e9cb3c617cdcc5d68f728e54f415dbfe0711c187636feb1f7a0826b510b95d20d19c28f3b28a2a21a65d48435e9c1f1b92303c0045f57b966fbc8ca95e0a586cfec3c541a09899b5b5dc61a0c29f3942d377c67166ec34fb55c5798e963a52c2aeb560803cdf21d9ab22e2482b994b432e3ab7fa5bc3e6d145f51645d22a2d9024a6dc49ad663e8323e791e31822afd868a7f43b6d8e1f2ff189876cbc9e3a5d76b3822f91a408fddd580757a66656929f2ea6114a7a1bd8d8adc127df13c5a8bd424f22941879a9b2643be98924c6aecc9dc12c0577544edc199e2f0905cfce7cb8a9d260320179a4292387b5fb280983568400fa99ccd1f8f29ebb54240573b01b122caf3360e6d7b4addc4e45d07bf538b338818a3664ef190009cb2605b9e9ccb619d652dd051e69b1d7572bed488f71bb1264fe8fe889e6cd821b0c4ad0f23c68d38193cbcff7497dfd0961e8e2f5604d9925897d9873a7b18d36c8c3d3e176d659fddff6cbf2163e324ea54fc49d6fc48ebccd4d892aa467350f8cbed5a691034fca3a399168f11023828805938b204a5dae4a73e065265e1c5b230fe3ad05a484583f8364388d1f4938fb4f2a2165473300e27644e9c7cd16312eedb9bb9cac2369db1adfd6da9f02f132eb4a159755d62a23fcfab9c3532d08854d362e791664370ca9fa6d4fa8c78f564483bba934b9034d6a0365f44c81be0978dcb51f7948cf3d2897be82fb3f418d12858352deb9fe3a987a77f282683aa1c46aa3e3cbc7eeeb7321b7db2fd8951c7ce3c7c42680fcfe7641c3d7be9e8d69a8fbb992a9d08676fe957d25d63e71ac422c4288887f658aea6bd2c75cb8eff5c5fa8365a996b436c55b23e3d9d1312ce1eb704856ee05aaff8a55b20e90e5974104b397cd23fb6a0b7caf34f6be639a5a4835bd458e69775601e7d4cea1b7b655b8d10a8b4c05c848d09e47e35df391baebbd7bd463fda7a�x������������� ��������X�a9^?a03a`
	p�m�6�$}����������������
m�l�n�
�








































	

 !"#$%&'()*+,-./0123456789:;<5.297.4.33-10.el8.remi20190902-647.4.337.4.3320190902-647.4.33-10.el8.remi7.4.33-10.el8.remi7.4.337.4.337.4.337.4.337.4.337.4.33











					

php.d20-bz2.ini20-calendar.ini20-ctype.ini20-curl.ini20-exif.ini20-fileinfo.ini20-ftp.ini20-gettext.ini20-iconv.ini20-phar.ini20-sockets.ini20-tokenizer.iniphp.iniphpmodulesbz2.socalendar.soctype.socurl.soexif.sofileinfo.softp.sogettext.soiconv.sophar.sosockets.sotokenizer.sopeclphp74-php-commonCODING_STANDARDS.mdCONTRIBUTING.mdEXTENSIONSNEWSREADME.REDIST.BINSREADME.mdUPGRADINGUPGRADING.INTERNALSdocsinput-filter.mdmailinglist-rules.mdoutput-api.mdparameter-parsing-api.mdrelease-process.mdself-contained-extensions.mdstreams.mdunix-build-system.mdphp.ini-developmentphp.ini-productionphp74-php-commonLICENSETSRM_LICENSEZEND_LICENSElibmagic_LICENSEtimelib_LICENSEphptestspeclphppeclxml/etc/opt/remi/php74//etc/opt/remi/php74/php.d//opt/remi/php74/root/usr/lib64//opt/remi/php74/root/usr/lib64/php//opt/remi/php74/root/usr/lib64/php/modules//opt/remi/php74/root/usr/share/doc//opt/remi/php74/root/usr/share/doc/php74-php-common//opt/remi/php74/root/usr/share/doc/php74-php-common/docs//opt/remi/php74/root/usr/share/licenses//opt/remi/php74/root/usr/share/licenses/php74-php-common//opt/remi/php74/root/usr/share//opt/remi/php74/root/usr/share//opt/remi/php74/root/usr/share/tests//var/opt/remi/php74/lib//var/opt/remi/php74/lib/php/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu












	














directoryASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a746a511386f769caba310f0a255ae9ee159852a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d260471763d43d9a6248ea673fb8f26c789d965f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=71f80f141276c233ce38fdba65bbfdba40e49be7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f8b65ade813c22ad07f811e8c356f419be53652e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0f05ea0f7a4edfea65a53af4771e58e6cdee00ff, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynami�x����������������������X�0?`��5�$����������������
55
�N/�?*�d
�
�	
�
�	
�	>
��
��
��
��
��
��
�
8
�	
V
�
s
�
�
�
�

�
H
,	B
X�
\���
@��y(�
8�59	x5:�5>$�
@$�
B$�G%H%8I%dX%pY%�Z%�[%�\&<]&h^'b'r
d(�
e(�
f(�
l(�
t(�u(�v)w)�x)�y*�*h
�*l
�*r
�*�


*�

*�6
-
-6

/H

/q
�/�

/�/�
g/�
h/�
Clibgcc8.5.024.el8_10GCC version 8 shared support libraryThis package contains GCC shared support library which is needed
e.g. for exception handling support.g�
mord1-prod-x86build004.svc.aws.rockylinux.org�KojiRockyGPLv3+ and GPLv3+ with exceptions and GPLv2+ with exceptions and LGPLv2+ and BSDinfrastructure@rockylinux.orgSystem Environment/Librarieshttp://gcc.gnu.orglinuxx86_64if posix.access ("/sbin/ldconfig", "x") then
  local pid = posix.fork ()
  if pid == 0 then
    posix.exec ("/sbin/ldconfig")
  elseif pid ~= -1 then
    posix.wait (pid)
  end
endif posix.access ("/sbin/ldconfig", "x") then
  local pid = posix.fork ()
  if pid == 0 then
    posix.exec ("/sbin/ldconfig")
  elseif pid ~= -1 then
    posix.wait (pid)
  end
end
�X*FRgH��Kׁ�A�A�A큤��������g�g��g�
Bg�
Bg�
Bg�
B`���`���`���`���`���a4c883911f6a5d7f0aaffda6e2cfef0760527ce8d038e69fe9c9bf94ff76ca28231f7edcc7352d7734a96eef0b8030f77982678c516876fcb81e25b32d68564c32434afcc8666ba060e111d715bfdb6c2d5dd8a35fa4d3ab8ad67d8f850d2f2b9d6b43ce4d8de0c878bf16b54d8e7a10d9bd42b75178153e3af6a815bdc90f748ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b903a853c2ffec17057872340eee242ae4d96cbf2b520ae27d903e1b2fef1a5f9d1clibgcc_s-8-20210514.so.1../../../../lib64/libgcc_s-8-20210514.so.1�����rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgcc-8.5.0-24.el8_10.src.rpm��������������������������������������������libgcclibgcc(x86-64)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgcc_s.so.1(GCC_3.3)(64bit)libgcc_s.so.1(GCC_3.3.1)(64bit)libgcc_s.so.1(GCC_3.4)(64bit)libgcc_s.so.1(GCC_3.4.2)(64bit)libgcc_s.so.1(GCC_3.4.4)(64bit)libgcc_s.so.1(GCC_4.0.0)(64bit)libgcc_s.so.1(GCC_4.2.0)(64bit)libgcc_s.so.1(GCC_4.3.0)(64bit)libgcc_s.so.1(GCC_4.7.0)(64bit)libgcc_s.so.1(GCC_4.8.0)(64bit)libgcc_s.so.1(GCC_7.0.0)(64bit)









rpmlib(BuiltinLuaScripts)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)4.2.2-13.0.4-14.6.0-14.0-15.2-14.14.3g�_@g���f!@eS�d���d,@c�.�c:�c5��b��@b�@b_��bF�@bDF@a�@a�a�a�A@a��a�@a�@@`�@`�!@`�f@`��@`���`pA�`pA�_s!�_�^���]�|@]-�@\��\��\��@\��\�s@\�s@\U@[�1�[ā@[�;@[�F�[��[l,�[^��[\Z�[[	@[GB�[�Z�Z�@Marek Polacek <polacek@redhat.com> 8.5.0-24Marek Polacek <polacek@redhat.com> 8.5.0-23Marek Polacek <polacek@redhat.com> 8.5.0-22Marek Polacek <polacek@redhat.com> 8.5.0-21Marek Polacek <polacek@redhat.com> 8.5.0-20Marek Polacek <polacek@redhat.com> 8.5.0-19Marek Polacek <polacek@redhat.com> 8.5.0-18Marek Polacek <polacek@redhat.com> 8.5.0-17Marek Polacek <polacek@redhat.com> 8.5�x�������������r�������X�ue�	?hand�{������h�������*58826�$:����������������
*5)5+5
�@lwdbadminrootrootlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlw�x��������������a�������X�0-7?vin ��������`�\om> �$L����������������
\[]
��1`s�1`s�1`s�1`s�1`s�1`s�1`s�1`s�1`s�1`s�1`s�1`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�`s�/`s�1`s�1V�SQ`s�1`s�X`s�Tk�%P��*P��*T��P��*WY�P��*WY�W\	`s�l`s�l`s�+`s�+`s�+Vf�Vf�V�SQVf�VzHkVzHkVf�VzHkWY�`s�+`s�WY�Tk�'VzHkP��*P��*P��*P��*P��*P��*`s�V�SQV�SQV�SQV�SQV�SQV�SQW\W\dW\jW\
6W\
=W\
6W\
>W\
6W\jW\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
6W\
>W\
6W\
>W\jW\
6W\
>W\
6W\
>W\
6W\
6W\
>W\
6W\
6W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
>W\
6W\
>W\
6W\jW\
6W\
>W\dW\jW\
6W\
>W\
6W\
>W\
7W\
>W\
7W\
>W\
7W\
>W\
7W\jW\
7W\
>W\
7W\
>W\
7W\
>W\dW\
7W\
>W\	`s�lW\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�`s�lW\�`s�38807a269f76f8fa147c45aeff7b60c3d206e869a921e0fd24595618808492932dcb4500ef2d0574d61cbd733d8dac1e6f051302b2b0cc1c5f682146703ae97bd6500b47e8dd42f1ef88d0effb9203bbc5d23f0bade3d6fac41468ae9dc4d3a2b77230f2251a673df49213806abe7f4e3cf129ef05132f11d618d4738bc1fe7047499de0b1e001a593f98e0b0daaeb1cf35a4b0dc916512e5059d46d5db404942eae84537620862a840cd4d08b11c36c8285ab128f1d1637f8e1449458e41e94363a9ca1e5e30ac14fb2f0ee4a4c3d38dfb4e8e555aff294a0eeefc8553d7c96d4829da4c5a44b6f99f8d12b18d7943f28b85f3731427e7077edeab85341d15c69b5783a56ab64bab3f69ed1eaea98f3e993c985a4dfacd9ecbb082f4c4813646703b2d5b7b217129f13edeb7d173ca1e131fa747ca1502608c1f4203ba4ca126e2197997df61a7dd01170e6cd39cd56730724c20681a0df55e7953e9f12b7b10f32680485723230ce2fe5cd8cd9e0b12aa44c24a77472d38d280037c36e6f67364bc091ff1302e2e872ac28d63ed3e48b8ccbc90eb92f5528bdc70de6d20ba102af1d85f66d4dc89be0fa2340d2314af0f6f57cd9bf4f896a0b2175845c76123b8c0f880082cede373f21fa9fc3d1127676ba731a66f22f6c8fca66d85f4a196981806d4e472c54585f58da4ccd6e06361197bbf5c53b4b7774097f9ae0f50c3a04a9bd7ba9d729b32be255a645b611af031ce6966f5450a13eeab3aaad2c744b1bbd4ea456fd1cd5d6b17b20072aad2548efa6383c49d714e9831c5e9b7a21e42843abadf7102f4e3dd89015551a1e3046b1659102cb731705f991c97af9167795fd76da686e058577e49f55f57ef51e6cff7efe0cb1fbce2cf5fa4634dff7081f25ba7e3beacfefdd2ac0d242888dff6a4f2878e84d438e14f611c34dd72ca8872906dd89bb13c5155da29a258ceb2942036ac06c1127a622ee29eb048ecd2f6f990858a05ac854b5809c652ce9148529b26bbdd8154ddf12764da0e82d2c0c7d6a642a318390ef48f3a53de456f1593fb1ae60497861b18d7bfb758e61f23220894eb086252ba417a438cd309a759996323aa818aa8befd4a0768eba9ff7b5a0860df3e21b2bfdef52893bfcdd5ca3a81f3714d5591682c845a1cbf46359c8953a637c1b38e4d8db4cdddffacb2096ac4fce6178403c842d68f8b0de95bd8ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b9033fe5361f24b7c49ba12911c08f5a33f9cb18871d95d9fb881f5b8a4793e04288676e5840760b6adfc1c825615a6ccae0d8803018a18e8a3c511d28d9b62f51af4336e4a9cb4becdd86dd91104bf57fb92d55910b3479499c77e1e27b9c21c7101ee8289abcf7f86d48b4b10fc82da76b20e39c238159f0e2bbd263d8d930edb59e983b35e4c818b00ee5568cede04ef1c2eb24d4dd96e4e91c9b904e866927950a5c49a50383b8a984e82f23e48b5ac1f5649ff0a07830d4f5403e0cde33d73bca4068f64726454f71bcd1670e4da6e3d8f96d596642554b6025f94548841056700348e6ed9006f0ef3d6c5beaf22fa5ac358b9a16c57e74b8ed312b3ef3592e3eb1a786c9d725ac8f41030c63e37ec94cf4db04d926398fbab5138e862695255d6d31196dca079b1c43f65282953af5d6586bd1ada936931ec3bb0a502cf3b11623b4cb92fd33a0c35ec9a3d5c3ee0d960f3288951c10b3dfb6d5670c2c65fe3a60192fe6f655e9373d6b3c5368b63cd4d8c66b0050a7bb67bd12b6171daa65f1c7ed8274f848d63b32b8ec66f438c8dbe67c659a939b0e6f649803dd59f7a4949781fbd03ce1e1a16b797a856edfe8cbf18550aa28e52bbd1c64434ab9da76d28bb08e5db9aadf20bfa00b963ef21b53804a7b76d4acd63280b6008cf4c85181c39f44376083d31004805c7e069fd681a8c2c98a4f8fa79d39b4800b71ac8739004a6f74a9a482bb70af3d17ba0d3ac32964e666302160dc8e6590eb1a35b8ed85e3a2a4ce7157180b40ffab00bd8a24b4891c9ffc3e3bc94cb161d62e744cd5a3b72f3d2a12b6740416c201b35c77808a981feae8a7c9b674cd3ee875e00001b364b311c593a1a80c02fe2dd68cbeff7014515f4d54b3bf62dc74370a179033234736a58f1610c73e1c8c08faf1b2ef1397d878dd7d2cbd888ca0f2da4ffc3b0b89aa6625c051e69cce1�x�������������Q�������X�elI?quir����������@ (#1�$����������������
�@<>
�D8?
(d
�
�
�
�	
�	N
��
��
��
��
��
��
��
�	�
��
�
3
�
9

@

D
	
F


H

L

�


�

�

�

�

�

�

�
�K(g
8p9�:�G
H
I
X
Y
\$
](
^8
bO
d	�
e	�
f	�
l	�
t	�
u	�
v	�
�	�
�	�
�	�
�
$



8


<6
r
�6

�

�
�$

(
,
g0
h4
Cghc-srpm-macros1.4.27.el8RPM macros for building Haskell source packagesMacros used when generating Haskell source RPM packages.`s��ord1-prod-x86build003.svc.aws.rockylinux.org
�KojiRockyGPLv2+infrastructure@rockylinux.orgUnspecifiedhttp://pkgs.fedoraproject.org/cgit/ghc-srpm-macros.gitlinuxnoarch
���`s��9f5eb72e2a8a561054c2c063555ba970dd93bb7786fb9ef53db8953ed097d1dfrootrootghc-srpm-macros-1.4.2-7.el8.src.rpm����ghc-srpm-macros







rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.14.3Zz�@Yx�@X��@V�m@V��U�a@U>$�U
�@T�-@S�\�Sc��Fedora Release Engineering <releng@fedoraproject.org> - 1.4.2-7Fedora Release Engineering <releng@fedoraproject.org> - 1.4.2-6Fedora Release Engineering <releng@fedoraproject.org> - 1.4.2-5Michal Toman <mtoman@fedoraproject.org> - 1.4.2-4Fedora Release Engineering <releng@fedoraproject.org> - 1.4.2-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.2-2Jens Petersen <petersen@redhat.com> - 1.4.2-1Jens Petersen <petersen@fedoraproject.org> - 1.4.1-1Jens Petersen <petersen@redhat.com> - 1.4-1Jens Petersen <petersen@redhat.com> - 1.3-2Jens Petersen <petersen@redhat.com> - 1.3-1- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- add MIPS to ghc_arches_with_ghci (#1294874)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- reenable ghci on aarch64 (#1203951)- disable ghci on aarch64 due to dynlinked runtime problems (see #1195231)- ghc-7.8 shared libraries allow ghci to work on all arch's- add pkg git as URL (#1093541)
- downgrade license tag to GPLv2+ in line with rpm (redhat-rpm-config is GPL+)
- sync with current ghc-rpm-macros: add ghc_arches for backwards compatibility- separate from ghc-rpm-macros

1.4.2-7.el8macros.ghc-srpm/usr/lib/rpm/macros.d/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuASCII textutf-8d3065f31be5f1b06336cbf2b063d5976919ebd01a33ead16edd372634415d3a0?���px�3
!pQ�p�)�Tξ7��]�mtZ``s��
	�]�mtZ`�`��|��c�J����l+ �#Ds�I�pݡ3z�:�X2:��&�w62�b����3���C�{��S!�^���]	�N?i�G!�8=cs40hH�%��U$
L����|��5gK�MYR�M���O�b�{�Ӓh�}
p#yzl���Ī�~E�?x�8J�Ҹ���}�GZ�K��x�Ƕ��Ghk�:a�8���pX�z���5���Ǡ/X�
����@C�N��]�dⲓ�~�0=�&��ʘ��QSrn�|e��|1�3s*���
��t6����?���Ѹ��t���j�rH@T�ݒ���z`&�x�������������x@�������X��?Э
�]�������4�$g����������������
�4�4�4
�e dtrace- Updated for 5.7.5- Fix Cflags for el7- Support for enterprise packages
- Upgrade from MySQL-* packages- Resolve conflict with mysql-libs-compat- Resolve conflict issues during upgrade
- Add ha_example.so plugin which is now included- 5.7.4
- Enable shared libmysqld by cmake option
- Move mysqltest and test plugins to test subpackage- Fixed isa_bits error- Initial 5.7 port- Fixed uln advanced rpm libyassl.a error
- Updated to 5.6.15- Fixed mysql_install_db usage 
- Improved handling of plugin directory- Refresh mysql-install patch and service renaming- Updated to 5.6.14- Support upgrade from 5.5 ULN packages to 5.6- Enhanced perl filtering 
- Added openssl-devel to buildreq- Removed mysql_embedded binary to resolve multilib conflict issue- Fixed Provides and Obsoletes issues in server, test packages- Updated to 5.6.13- Added files list to embedded packages- Updated libmysqld.a with libmysqld.so in embedded package- Updated test package dependency from client to server- Added libs-compat dependency under libs package to resolve server
  installation conflicts issue.- Removed libmysqlclient.so.16 from libs package- Adjusted to work on OEL6- Move libs to mysql/
- Basic multi arch support
- Fix changelog dates- Major cleanup- Updated to 5.6.12- Allow to override the default to use the bundled yaSSL by an option like
      --define="with_ssl /path/to/ssl"- Replace old my-*.cnf config file examples with template my-default.cnf- Let the installation use the new option "--random-passwords" of "mysql_install_db".
  (Bug# 12794345 Ensure root password)
- Fix an inconsistency: "new install" vs "upgrade" are told from the (non)existence
  of "$mysql_datadir/mysql" (holding table "mysql.user" and other system stuff).- Add a macro "runselftest":
  if set to 1 (default), the test suite will be run during the RPM build;
  this can be oveeridden via the command line by adding
      --define "runselftest 0"
  Failures of the test suite will NOT make the RPM build fail!- Add the man page for the "mysql_config_editor".- Make sure newly added "SPECIFIC-ULN/" directory does not disturb packaging.- Removal all traces of the readline library from mysql (BUG 13738013)- Fix duplicate mentioning of "mysql_plugin" and its manual page,
  it is better to keep alphabetic order in the files list (merging!).- Let the RPM capabilities ("obsoletes" etc) ensure that an upgrade may replace
  the RPMs of any configuration (of the current or the preceding release series)
  by the new ones. This is done by not using the implicitly generated capabilities
  (which include the configuration name) and relying on more generic ones which
  just list the function ("server", "client", ...).
  The implicit generation cannot be prevented, so all these capabilities must be
  explicitly listed in "Obsoletes:"- Add support for Oracle Linux 6 and Red Hat Enterprise Linux 6.  Due to
  changes in RPM behaviour ($RPM_BUILD_ROOT is removed prior to install)
  this necessitated a move of the libmygcc.a installation to the install
  phase, which is probably where it belonged in the first place.- "make_win_bin_dist" and its manual are dropped, cmake does it different.- Add mysql_plugin man page.- Set CXX=g++ by default to add a dependency on libgcc/libstdc++.
  Also, remove the use of the -fno-exceptions and -fno-rtti flags.
  TODO: update distro_buildreq/distro_requires- Add the manual page for "mysql_plugin" to the server package.- Null-upmerge the fix of bug#37165: This spec file is not affected.
- Replace "/var/lib/mysql" by the spec file variable "%{mysqldatadir}".- Source plugin library files list from cmake-generated file.- Added the mysql_plugin client - enables or disables plugins.- Fix bug#12561297: Added the MySQL embedded binary- Fix bug#45415: "rpm upgrade recreates test database"
  Let the creation of the "test" database happen only during a new installation,
  not in an RPM upgrade.
  This affects both the "mkdir" and the call of "mysql_install_db".- Fix bug#56581: If an installation de�x��������������/�������X�Rr?R���������|^E<R�$N����������������
^E_E]E
�ebuild-  Turn off sensitivity of details button when no AVC's exist- Add ProtocolError from xmlrpclib so Bugzilla reporting throwing an error will work.- Fixup for allow_execstack have to add pid to avc struct- Fix email_alerts to work with new infrastructure- Added details button and context as tooltips to gui on front end for advanced users- Fix man page to reflect change in gui
- Fix sealert -fixit call to import load_plugins
- update translations
- Fix handling of empty tpath in gui- Fix dbus Introspect handling
- Make sealert use terminal for errors when in terminal mode- Update Translations- Fix Details Button
- Fix table display
- Handle situations when you have no spath and tpath- Fix dbus config file to allow console to use sealert- setroubleshoot will create /var/run/setroubleshoot if it does not exist- Ghost /var/run/setroubleshoot- Update translations
- Allow seapplet to check for updates- Better handling of tracebacks in terminal mode
- Fix up messages on process and capability avc messages
- Update translations- Fix config name- Fix crash in sealert with missing log_*
- Report bugzillas in english- Apply patch from Yuri Chornoivan to fix spelling mistakes
- Remove py files that are no longer used
- Add details button- Fix handling of report_count and ignore button- Add white level, so plugins can tell setroubleshoot to ignore avc- Fix browser to handle ignore flag
- Remove tpath for signature 
- Fix audit2why handling for sealert and setroubleshoot
- Fix sort order selection
- Fix dontnotify handling- Update translations- Fix saving last position exception- Fix seapplet infinite loop from Tim Eliseo- Fix requires setools-libs-python line- Fix setroubleshoot seapplet to not show ignored avc- Remove packagekit dependancy- Add Gavin Romig-Koch report patch
- Cleanup Browser window
- Remove avc messages that are allowed or dontaudited in current poilcy- Remove untest attachfile code
- Catch ProtocolError- Fix remembering of bugzilla username/password- Remove send_interface from Setroubleshootd.conf- Don't crash on missing inode
- Fix up default_encoding an translations- Cleanup spec file
- Add default_encoding
- Fix wording in bug report window- Fix ignore button
- Add delete button- Exit with error code if you run sealert as root and try to connect to session bus
- Fix Crash when ino is not defined- Fix bug in substitute code- Fix semanage fcontext lines to substitute "." for " " in path
- Update po- Fix bugzilla reporting to work on RHEL6- Do not translate hex files
- Catch exception on non dbus system- Get version correct for both RHEL and Fedora- Fix crash on selinux disabled and bad /etc/redhat-release reporing of bugzillas- Update po
- Fix bugzilla reporting to handle LoadError exception- Add icon to browser- Fix up browser button handling when there are 0, 1 or more alerts- Catch additional bugzilla exception- Show that the application is starting.
- Fix ignore sealert button- Don't throw up an error box if yum cache is not setup- Fix Fix It button
- Remove Setroubleshoot: from every heading- Fix translations, plurals and glade
  - Update Po
  - Fix plural form
  - Add support for Green Plugins- Fix translations, plurals and glade- Fix browser bug handling- Fix translations- Update po and fix translation line-  Fix permissive domain check- Close open file descriptors on exec- Fix setroubleshoot error dialog and hash to catch more dups on reportbug- Fix pipe and socket plugins to return tclass as path- Fix permissive fix- Add PackageKit requires- Move  python-slip-dbus requirement to server package- Fix Permissive Domain reporting- Turn on libcap-ng-devel- Differentiate between permissive domains and permissive mode- Turn on libpcap- Turn on copy to clipboard button-Update to upstream 
        - 2009-8-18 Thomas Liu <tliu@redhat.com>
        - Added check for new policy.- Default syscall field in audit_data- Add buildrequires python-slip-dbus- Add sgrubb drop capabilities, patch
- Fix infiniteloop- Fix handling �x�������������h�������X�17�	?ule+�2x(������505.r�$����������������
555
�d6b640af64f24a8b76e7adb4b4312c74ef3b34fe75e787c496b428af4cb1b49faaf5606d0746900e001ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b14f630bd4fbc0322d7c62a5bd8b2b885d7bc94d562fe9815e2e25359e222506b81b51761e1ab72ba9c39cef406316dc47b419f04aaa2bf92956620663ca910e08b9f3d05f45d02d2193e909a44f3b24afa5efb68c7dfd498b2655323f906e2fcccba6a636cd207b104c181d10df62537f3eb141a7c8383f664d5a803c6c471e0494cc1bc8e8ccbc8df903cfc316d0cfba14a56b7c6857c053ffdf740a675777e35e035ad5e8e7f55540555133d566a5bad7291f3cdc76fa8a5fdda79a780926d81b51761e1ab72ba9c39cef406316dc47b419f04aaa2bf92956620663ca910e0c385777b1b1306331a801d216cfa7b76456e82aa72bfb5174ab99d13d9533e044ed2db641ebe94535ab6e4024519566bc05334cdcccb193cf3ed404cbd970321a51660490537b73deef875ee649dbf5cf515ecfedc68374a397cbca72f631957a77c9c316dbf7a1d0b1246a7955fb99457aed2eb59def7eee33a58d039a121218bbc8f713057bca08b4c2e452825d36700bd95a5dc2ed872d6777ba8522148ef7813e8525c3e44d34b02f3b610c6d455e890afd0a593621a00a33c16d8bbbf6f86a69eef5822555e86d886462783be13a3a88d43405f4695d4e93aa83ec63bf233bfc6d6fd56aa1e05011b5c936e7cb8cf2e8fec3ac249d2e69e280fb7a0660184dac3d63b608e986a44d31645a16964eb6516745383c06357b5159a2262d475401c123108eb38efaad278fcfa601611b4383d2507066a3aa3c681b0fcbd6269a2000d6cfeb9e9c1aeedc25fc02ed59f1c8f832595e51f102c988c047a2abd5181b51761e1ab72ba9c39cef406316dc47b419f04aaa2bf92956620663ca910e061c4096d59329c3f5a132f96d85b5f4280aa8d0a1fa93b0aa119be59e62cbf3b0f552bfe74ce9f5c5843223a00a7b682350263080cb592545d0805e349386f6f53320918770e3e5a59f7fac045a84dc130278c65b72919589e1a2b13160a1d758f947f47aece2538ba8d74977db2d784e94edb5f19b79b9714e79b1f0578b0128ab8e5c00c254f0352823c9ff2bddf117acb0b7dd4fbcfc45dae222ff43e995e81b51761e1ab72ba9c39cef406316dc47b419f04aaa2bf92956620663ca910e0af49b11428521c4cbef9ee93c201dc28010837ca6703e75c35eaa0e8a8a960db52676fa17c722a9d984992aac6b9883d4629399ebb787772c7a9e16c43081ffb9d0aa595429d4a1898463da70dcb1690c9902958ce0fcadfabffd8f93e8e9a5044d833998dde8b4f5b428f9b9813815b68c0d03bd8384f08f412a4d27518b827cc47baebfde5831d48273baccbc5647d322818d24021bdbeabb290785275f8d5b2aa6d9f7be13539c80c8107b00684213a69252777db60fe31f3ac0ef0e3fb83df42dbae16a5aa1a1fcf05f9c2e52c84ed6da86e55d105fe603bf0c0fdadf7bb66e5e20ada402d168c0e2f835632701b105bb7c6879a4ede007f41f19e4c282f88124a252ad566396a2409c2a0adface1e64dad0cec3d685b0128ead3f00848e53af700c92d2da4a6358dfb802b8d9eb445e47964615fdc91a25d856c131e47e97121073d043aab1ce2a59f9357ffe378f7572e116d65bf823682c60a3aa4513e77f5bfaa20c9d34e4ca1b1ebf6fbbea413a5e83da37b706f42327f8b3c4d28221815117fe441711136a81527b9ef0da73e879534d50f8aab98bc46d1426f2a499685f3a8a57bf6b7c66e3fb2e005fe85cc31c814165820118cd09a8f9e96cbd99685f3a8a57bf6b7c66e3fb2e005fe85cc31c814165820118cd09a8f9e96cbd99685f3a8a57bf6b7c66e3fb2e005fe85cc31c814165820118cd09a8f9e96cbd99685f3a8a57bf6b7c66e3fb2e005fe85cc31c814165820118cd09a8f9e96cbd05cf0f050d072cfced80525951e3e8f1dfda05a24ae554a3d7af51f0180453e53764db7316f9a865f6636eb615e672be7e452e267310cda3dd3b298fdac26eb23764db7316f9a865f6636eb615e672be7e452e267310cda3dd3b298fdac26eb23764db7316f9a865f6636eb615e672be7e452e267310cda3dd3b298fdac26eb23764db7316f9a865f6636eb615e672be7e452e267310cda3dd3b298fdac26eb2a292be26cd241eed4c5be339225321bfd428aeda4be19c75f0e6431b445553ba81797683f98b6ba4f043dc62daa1117b2e5194a73826c87448fb7321501b25c97a8f0d4e6b3217d343deba9707a889e5d6bb05154b881f0f235125f3082242bd2eb5ce6fe1431e3bb78c213a7b0ccc31b794e2d9ed91ee99676ff8066e4073b1a1a4a4d625b3cd32cc00ebb1fa0ef2c1156e3b776b3a46b3ad20022d02ea259e6aba85654770e58c88e33ed33414c98bf7727afcf1ea4acbc81eb32dbc23ad52dd1d376c6d9298890e2fc900dc2bac321e2583464b83f2ed2db6d0a3173f7c5bceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f1508314120dc65f0800f738a4b31400c76ee14decd1fbe77ce9c3540a421b86ea7b6873e05768f2c38529c36a67cc29e01a7eb713423810a7c3dfa579847b401679255add53218b3eb44883de4cf84b756214c77cacbdd2d632ecaf2518b984aff32e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8553aa464174798e461ecb0ca2b16395b4c8ab4ef6be91e917ad1f21003a952f7�x���������������������X�re�?g@liP�p)������˞g> -�$[����������������
˞՞
N
��>�,T��V�u�E_;���ޅ��_.l�vf=ŒQA�U!�rW�
�N�)@�
P�n�}�^�-�V��A�%��@�K���
�^N7�q���^���1���i�/���5�p��Ns�)�������
�%��>�H�2��20f~v���2�K�ֳ�$m_&��`!\�oլ��vy���w���C"�ƞ��8�+97938cb0d9e166a35551bad4c373af961bb0e67ac7870e974e7fe5cc15f1dfd8c3ebc25c4bcff43fe8f16b8899e1b300eff2845dg�En�g�EotrootrootrootrootrootrootrootrootrootrootrootrootrootPercona-Server-57-5.7.44-48.1.el8.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������MySQLMySQL-clientPercona-Server-client-57Percona-Server-client-57(x86-64)mysqlmysql-client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@







@Percona-Server-shared-57libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libm.so.6()(64bit)libncurses.so.6()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libreadline.so.7()(64bit)librt.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libssl.so.1.1(OPENSSL_1_1_1)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.11)(64bit)libstdc++.so.6(GLIBCXX_3.4.15)(64bit)libstdc++.so.6(GLIBCXX_3.4.20)(64bit)libstdc++.so.6(GLIBCXX_3.4.21)(64bit)libstdc++.so.6(GLIBCXX_3.4.9)(64bit)libtinfo.so.6()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-1Percona-SQL-client-50Percona-Server-client-51Percona-Server-client-55Percona-Server-client-564.14.3ehy@`3��Y���W�@W��V�@V�w�V��@Vii@V
}@U��@U\w@Tи@T�@T�@S�S��S�.�S�@S���SX��SB�@S9X�S L@Sc@R��R�
@Rj]@Rj]@R^�REs@R6�R' �R��R��R@Rq@Q���Q�M�Q�Y@Q�Q�@Qֵ@Q��Q��Q��P��@Puc@Pn�P�@P@O��ON@N�@Np�@NoE�NoE�Nh�@N\�N\�NNP@NE�N-Z�N(�N��MR��MF�@L�LΫ�L�d�Lb��Lk@L�@K�@K���K�[�K��@K���K��@KuB�KK�K2@K
>�J�1@J��@J��J�u@J���J��@J�:�I-�I�@I�@H��H��@G��@G�@G�s@F8}@F��F
@E�{@E��E�=�E���E�<�En�E\R�EX^@D��Do�Da�DU�@DR�D<�D;�@D.k@D
u�D$@C��@C�t�C�.�C��@C�O@C�f@C�+�C�@C`�@CV5@CV5@CP�@B�@B�`@Bץ@B��B�:�B��@B�h�B�E@BfD@B]	�BQ,@A�@A�b�Aڅ@A�?@A-�A%�A��Ag@A�@�@@��@@qJ@@+j�@�@@�?��?�@?�\@?�s@?��@?O@@?/�@?�>��>���>l~@>H�>5@=2�@<�{�;��@:��@:Q�9�%@7�7�O�7{X@6�F�6@A�5��Percona Development Team <info@percona.com> - 5.7.44-48Percona Development Team <info@percona.com> - 5.7.33-36Evgeniy Patlan <evgeniy.patlan@percona.com>Evgeniy Patlan <evgeniy.patlan@percona.com> Evgeniy Patlan <evgeniy.patlan@percona.com>Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.11-4Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-3Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-2rc2Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-1rc1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.9-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Bjorn Munch <bjorn.munch@oracle.com> - 5.7.6-0.1.m16Erlend Dahl <erlend.dahl@oracle.com> - 5.7.5-0.6.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.5.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.4.m15Balasubramanian Kandasamy <balasubra�x���������������������X�?��������ȍ�4�����$����������������
�4�4�4
�e198a7d602e56708bc923ffbb7392290573febcf8a6cfd61a7202283187af02447702f5e7b47d64eece47d36cc82348c185e47a0a8199f78477c7749331122c6e4b8807a4b776edfbb0f3e4b83d59b7ac67d4f2a0ad2fc9bbbe493c712e8667085ab8adaed1c962fea302faadca89768ff0a40879135bdb39f8181945827fab475374c0132c6a38c67cfedfd27e739a0de729bd7fc85d39066ab1513a05cfde3f2ccae48f921f98b887079d01be6e2bdafc27af1d73325e2bc2ab937a6b36af72b691738e8988e2866548eb1028af6a91655daa3d3906a022570f3249c1da71d255f0eaf7e963ca7721271e07138433f009c7f07fda0ddae88f42795ab57be5ae73786531613c5f328b6da2a8372f867a2e7d7421e5fd84687dc6193204623b9b79f23e630b4786279f6cf75ef2a5f37d439b60505d54df8909baaa6d01eaa1c959b7374e82e2ab5454e35fef6c89079216552cd42de3915a55f681b083c5ae90805c7b16dcf7b33edbf20231f30bfb1ddb71708f085e9d1cc01c876fc371d22b8a877248df6324d40dd3d97457f422e9e82d49a54414c0c0bb070b89858d12954e2bc53ed5cca5e2763b7337f77bb21ebbaffccc98ba9672f4c0a0cf2cd181b64872f7e5837cfc7a85b624001bac3d4cb218230319884be3b06e2205da2404c765acafcf28fad8991d412a42b60fdbc6f0935eab82f7c2e6ffc1fc042c2f9426cfed72bd7eb878db6c0b84a7f013e9bc88ee1a7437449cea27ef1ae96a61364c68fbfd7827b9b8cdf45b1169ba9bdbbd4b7abd1e23af3f650ba692cf63158ffe5150c83d0173d3803950a31845c0d28f419b55665c227b529136a04d18b2fcb99c980e9651b6d57e7762aba0d8ae4bd869eadeb3bb8dd66bf2160d42c859ca686d09f9268fb5e9b9fc9162131fae853ba71c35e81aadeb23877fe2b1a0b62b72de4caa5806213b9b95abc4cffb8b75936694567f4faf9a1e139cd6aab3c351fc11ebe6bdedda0362544914a3a46e04362fcb3e8f31d1f7a134103bdfa9d89441ffaa4a28012a3f4a691fc6804b202062e6b83744260236800aca33550366468db9b0beace5534e9ec70a042e040c1c4c51620100e23ad57de93fcf20d7713f78c6e6b416cea397a0969a54ea23d1fc549c8e9746c2b4d6c32ecb7db9867597adbc222e7dc4987b267d6e4201bc10690200b2d947904f5fde17ac06c59a2644cd10f4fe312dee39b287c62f03fa59dbf0da12127ada39514fa4623d7bc9627d92a6edaec16422af79492bbd0d2ed58290ac4b5759180a16b25803965d2fa2530f9114053ba09f2d221e58e57599b03aa79c7389e98c63ccc2ce4f96b11dfd196325690d116ef31f918b796a0d67f0cea06f2bfa97324c781cde152c02fb438d0a07a536d44f3e536629695bc37268f063bdfb8ccb61d021d51e02713695a880d6d7faeedd093321e4f00bde9a683047a30258a2304a81a592c2bc64810a228b1a819654d984660fd639ece0f2350e5344fac178be08b0fe356db1d35690bccfb7eab2fb76041219d80f31969558ae6b8f9c5b30bbe074f66543b3b0b4b4c694db70cb368235f02649667affcb6951169a8a1231d1ef0bb885fef59e99ab92ce1b42da8582f3de225d5a6f209967fe91604d08c1c04a600090ca8703ac1531d1224f0afdaadb0eacb7ef98f4f2f9cacd45318d1bb080fad9a2e24ed11ba35605c5bea942054f2336aa4f7f62532045efa83f7d7a93cb3b071b7ba92f6b70350f79e426be0cd41fb821791d4ee5c8c22930c9035fdb73b04e16b8081e104581a4dd0a8906e91ecb51bb2fc601a5e2ec59241d8581a939f835f09043498c6f654435229c722c6474cb23ed986b59fb75c8610662f1b31c7cc7ac83fa89f377bce09c63ad926b980191d6c2acbda8d87bcf321e6fc2b5b329e65cdbb34b4145c89de20161a46a990778f11b89904a684c26b92c6481f5622cbd2530e569e017367e8487eeebd1a444e20e8ff59f909fc810c8707af025866918cd5b8b9977037f8ff4de9f5803d418d201c3f365058620fb22e7241f71e53d2fe0c5798554b8e8f388af9d2b73342d6ffa175bbc2af130184214928b677c731b35e3f9ada9cdb00bff6acff750e29fb51bdec9483bf4282f4837905d47b0b609bf9c7ca8205a45e6b8d54c2f9314567da6c2ddd3b76f22a6b827c3e1794d09e22c47570f3afd70ab39f2cd13b45b499382e33ac292b393de366c81bd68438d52f1fca5b93d90285309b7d4c24b9e2259a39246861b878fd6b62fc884ffd509c884ad8f8027e4b6263ce5f3fd765bf7a69fa6fa0c6fc77eace6d101821d09efb5d24be3dd57a06615bcfca3c59ed2aaed8bc5da6d5cd424a359727139e68c905327a9eff1a0eee1cd19c00dea4a7f1cd3c22b8fe2925fdc2a578f707429f12e968d097f2bec5d9558e6fa9372219d28f0551ac9a0fc06122a74397c42b71d7f3ec2c41e5afbf4a4cac7636b65e6ff1dcd96e7ad9c746945fe6d3a0d6ac8bee6cfd4239dac4b6d7097d93cd28f22aaaf4c84f9e0c0b1cf295922d792480f625a3ba3380b1eb62795e922f255307319033094437bce1d0b9d29e37fff9a6f409eb5cf72fbe08f4e96cfa49c3aa09d481230615b160a140b0a4cea9de640b78c20085bf1baeeb42fd9629860e8669bc323a52f91dbb91f0aa6337aba56a9158d584f35683272bae685b03d0e4e5954dc2fb563bb1f9ce5f45de5f5a7fd5d86ca16c83a4264c45c0fe22081de0aaaebe60d46c8464987021cacf881b6292a1cb003e4003548649ce917c2d4bfbf6329789b2b6efbfb17016dc04ef3fa3c6�x��������������������X��?p���������h�$O����������������
�h�h�h
�04071751e3c68cf2aa8f3e33bd3ac76ad2ef36c8e53c571a82ddd79c561d98b581f22d6779d03a7e452976fcb4b0b629dede282f2558ee1b744e8da86a44ea17886a6533f71428bc04e02596c3df11cc2b9f02ef2d061302f7b19e805726bdcbf70c05d7fba9aecc87b141d75ecc8b989500e4721ccc9610d811732d68dcd7e08b1bc2d51eec1f7af5de4b727fb3741402e8a845cbd5c05aae6369484a168842f1020370cdd50e9457bd1540e8e7cbf406907f1be1c4770dff0eac03236afd63de4b8d10669a0335b3d222d622dc7388dc894d90bc3207137cc67853859ebb9cea71c8f8cc7098d08d3db522067c9b4b2aa1a49aa36e1bce43e7a676fb7f1d9e28cb01330b19aa894871806d2d9537b7deaceb14933f83d368d7cce4ff88d6a4807fcb5ba2b8f7e66d4c50a7ba6393221682dd48c79f4c9286ac96b048af86a4807fcb5ba2b8f7e66d4c50a7ba6393221682dd48c79f4c9286ac96b048af85fae15bc63cbd806d444ac1846c5893975c60183a217fbf6aa2c5e4e40142ee563e7e9bfcc1d1d9ceff433c2686002a4c481589e9a9aaff57b447f8bcfde978cb1dede8f0841a1c083c7fc06f6b22cd0e699f07b6698553c642e8847f4b42ef8b797b5da16d1da98bd5787b35834c1e0933e0084949c63a499c9d81de937c6381ffc89f7512d0d6bb6d2fe49b0498578372489854c8691379cc704771c5df888f04895f72a5bdc440942cb0f707d4765b74db1b46faac16727bc0f1441b0148a17436b6eff0a093d8eaceeebc1ad37a26e0de0664a0259dc7beaebf9c80341afe5d96209a582c47f6347410f011a188306d69ff070b58ede1e80381a462bbf0623b9715a9cbd5ca10b049d02558893ece3d6d2190115ed243696c40705d5fd74de6c3144c0e4e50e4ed6b49738445b4035e116ac032618548ad7cc5bfaa9502a5ee5351c2b0613fdf31af051221630da207e2210852b8f8fc70fe3322a9d355934a4bce279782e32c8a1a77a3907e09b28199f898cbeba24fdbd4dd6dcde6dec5540d6c66bb9aede101e519346d005bba5b98ef7cbe960637830337a8072d0e3f546f07c42f9418e37ea8308d4bb455a8861a19f94cf01ef1b2663507fea864c7fb311d7b7539336aa90231256c7b2382315acf55231d99342c681f1c6737ee25864ede6989eccedbb73e0dbc7a9794384f715fdb4039cfbf3bda1bf76808586055b7ac88ac33172687e503927a0c921cb0951f5bf5c479584ecde9534c50cfe6010c9b026634a9eb60968f19929247bd927f6b8471e3db90aeb3ace12515b7734e899ff9843ef603ac3ee30563f1ac0714cde7e752a6c3521cfefc75e5716aca20fdcb9941bd1023aba429915f6563e5af51e02413cf9f6bceda6fdb23d6531d95efe5c60f48d116f10ea376eda65d48ee4530699214166aa701561ea0cc0fbe46adfa923f6f9d2c6268653ab683a7422a4c90c716b69f92108979490a86041de1083bc10cfaaeba994f31c2b65087e0bbc3a2d01a6a23cc3a433eb1ef7f201d8f6cf16c4386e02430f0afca0977244ffbb6987bbf03bffe7eae828081642b035ff3699d7969e6c8ea383243321c362dafe798a69606c318dceebe27082424358a78b8c3267afcf8b547f6006dabb977ee8df9ababad91e7a49cae4f3921be282440cc3d49fcc3e43b87ed7f3f6dd61c5ced4d6ce9618d55d8d2149639e6682fb90cf0cb7855002ad8a26f562a77ca7b4c8a7c7ec21612c02c856337f5f146c9000a47ecb256d819b0736535b5acbe3fc0092a871bc8b50fd59f0f46a109f39275fd4ada2a64367717cfd29ebe55686f378f19d606cb26a201526a1b5fed88bc825f5b50f57283d5a65ae94bd397d8b0649ec39c0b4fe0c90b6eb202b9a87ac75e108fcbc139eb8f7a54af6a6e24958db577b48e5c4f1df1922ff3151ee09f8b864d391ac8db54a95ce2b8bacd98c3ef83bd96f44fdd1dcf9e2c3267336f2f3b91a6cee7621d774e5237d35ee222a00f47fe81ea7b49a1ed9cf4493d67b886f6d6c177814528f8fc7cd74b0cd965b4d54abe8ff14936ee61a93516956d610006f307342366a452c0f66298074f1119aa1cb24f7673e4bbeb11aa3001335aba0c32a3ac395af6321efd28be73d06a00f0db6ab887d1c21d4fec46128d2056d5a�x�������������8�������X�m@i?at.c�����������*
on <�$:����������������
�*
�*
�*

�dudka@redhat.com> - 7.56.0-1Kamil Dudka <kdudka@redhat.com> - 7.55.1-5Bastien Nocera <bnocera@redhat.com> - 7.55.1-4Kamil Dudka <kdudka@redhat.com> 7.55.1-3Kamil Dudka <kdudka@redhat.com> 7.55.1-2Kamil Dudka <kdudka@redhat.com> 7.55.1-1Kamil Dudka <kdudka@redhat.com> 7.55.0-1Fedora Release Engineering <releng@fedoraproject.org> - 7.54.1-8Florian Weimer <fweimer@redhat.com> - 7.54.1-7Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 7.54.1-6Kamil Dudka <kdudka@redhat.com> 7.54.1-5Kamil Dudka <kdudka@redhat.com> 7.54.1-4Fedora Release Engineering <releng@fedoraproject.org> - 7.54.1-3Kamil Dudka <kdudka@redhat.com> 7.54.1-2Kamil Dudka <kdudka@redhat.com> 7.54.1-1Kamil Dudka <kdudka@redhat.com> 7.54.0-5Kamil Dudka <kdudka@redhat.com> 7.54.0-4Kamil Dudka <kdudka@redhat.com> 7.54.0-3Kamil Dudka <kdudka@redhat.com> 7.54.0-2Kamil Dudka <kdudka@redhat.com> 7.54.0-1Paul Howarth <paul@city-fan.org> 7.53.1-7Kamil Dudka <kdudka@redhat.com> 7.53.1-6Kamil Dudka <kdudka@redhat.com> 7.53.1-5Kamil Dudka <kdudka@redhat.com> 7.53.1-4Kamil Dudka <kdudka@redhat.com> 7.53.1-3Kamil Dudka <kdudka@redhat.com> 7.53.1-2Kamil Dudka <kdudka@redhat.com> 7.53.1-1Kamil Dudka <kdudka@redhat.com> 7.53.0-1Fedora Release Engineering <releng@fedoraproject.org> - 7.52.1-2Kamil Dudka <kdudka@redhat.com> 7.52.1-1Kamil Dudka <kdudka@redhat.com> 7.51.0-3Kamil Dudka <kdudka@redhat.com> 7.51.0-2Kamil Dudka <kdudka@redhat.com> 7.51.0-1Kamil Dudka <kdudka@redhat.com> 7.50.3-3Kamil Dudka <kdudka@redhat.com> 7.50.3-2Kamil Dudka <kdudka@redhat.com> 7.50.3-1Kamil Dudka <kdudka@redhat.com> 7.50.2-1Kamil Dudka <kdudka@redhat.com> 7.50.1-2Kamil Dudka <kdudka@redhat.com> 7.50.1-1Kamil Dudka <kdudka@redhat.com> 7.50.0-2Kamil Dudka <kdudka@redhat.com> 7.50.0-1Kamil Dudka <kdudka@redhat.com> 7.49.1-3Kamil Dudka <kdudka@redhat.com> 7.49.1-2Kamil Dudka <kdudka@redhat.com> 7.49.1-1Kamil Dudka <kdudka@redhat.com> 7.49.0-1Kamil Dudka <kdudka@redhat.com> 7.48.0-1Kamil Dudka <kdudka@redhat.com> 7.47.1-4Kamil Dudka <kdudka@redhat.com> 7.47.1-3Kamil Dudka <kdudka@redhat.com> 7.47.1-2Kamil Dudka <kdudka@redhat.com> 7.47.1-1Fedora Release Engineering <releng@fedoraproject.org> - 7.47.0-2Kamil Dudka <kdudka@redhat.com> 7.47.0-1Kamil Dudka <kdudka@redhat.com> 7.46.0-2Kamil Dudka <kdudka@redhat.com> 7.46.0-1Paul Howarth <paul@city-fan.org> 7.45.0-1Kamil Dudka <kdudka@redhat.com> 7.44.0-2Kamil Dudka <kdudka@redhat.com> 7.44.0-1Kamil Dudka <kdudka@redhat.com> 7.43.0-3Kamil Dudka <kdudka@redhat.com> 7.43.0-2Kamil Dudka <kdudka@redhat.com> 7.43.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.42.1-3Kamil Dudka <kdudka@redhat.com> 7.42.1-2Kamil Dudka <kdudka@redhat.com> 7.42.1-1Kamil Dudka <kdudka@redhat.com> 7.42.0-1Kamil Dudka <kdudka@redhat.com> 7.41.0-1Kamil Dudka <kdudka@redhat.com> 7.40.0-3Till Maas <opensource@till.name> - 7.40.0-2Kamil Dudka <kdudka@redhat.com> 7.40.0-1Kamil Dudka <kdudka@redhat.com> 7.39.0-1Kamil Dudka <kdudka@redhat.com> 7.38.0-2Kamil Dudka <kdudka@redhat.com> 7.38.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.37.1-3Rex Dieter <rdieter@fedoraproject.org> 7.37.1-2Kamil Dudka <kdudka@redhat.com> 7.37.1-1Tom Callaway <spot@fedoraproject.org> 7.37.0-4Kamil Dudka <kdudka@redhat.com> 7.37.0-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.37.0-2Kamil Dudka <kdudka@redhat.com> 7.37.0-1Kamil Dudka <kdudka@redhat.com> 7.36.0-4Kamil Dudka <kdudka@redhat.com> 7.36.0-3Kamil Dudka <kdudka@redhat.com> 7.36.0-2Kamil Dudka <kdudka@redhat.com> 7.36.0-1Paul Howarth <paul@city-fan.org> 7.35.0-5Kamil Dudka <kdudka@redhat.com> 7.35.0-4Kamil Dudka <kdudka@redhat.com> 7.35.0-3Kamil Dudka <kdudka@redhat.com> 7.35.0-2Kamil Dudka <kdudka@redhat.com> 7.35.0-1Kamil Dudka <kdudka@redhat.com> 7.34.0-1Kamil Dudka <kdudka@redhat.com> 7.33.0-2Kamil Dudka <kdudka@redhat.com> 7.33.0-1Kamil Dudka <kdudka@redhat.com> 7.32.0-3Kamil Dudka <kdudka@redhat.com> 7.32.0-2Kamil Dudka <kdudka@redhat.com> 7.32.0-1Fedora Release Engineering <�x���������������������X�-p�?son(��������ЕR�erp�$B����������������
R�S�Q�
�ython-test sub-module, over 3MB of stuff noone wants.
- Don't remove egginfo files, try this see what happens ... may revert.
- Resolves: rhbz#414711- rebuild for new libssl- Fix pyconfig.h comment typo.
- Add back test_support.py and the __init__.py file.
- Resolves: rhbz#387401- Do codec lowercase in C Locale.
- Resolves: 207134 191096
- Fix stupid namespacing in pysqlite, minimal upgrade to 2.3.3 pysqlite
- Resolves: 263221- Remove bintuils dep. for live CD ... add work around for ctypes- Add tix buildprereq
- Add tkinter patch
- Resolves: #281751
- Fix ctypes loading of libraries, add requires on binutils
- Resolves: #307221
- Possible fix for CVE-2007-4965 possible exploitable integer overflow
- Resolves: #295971- fix marshalling of objects in xmlrpclib (python bug #1739842)- fix encoding of sqlite .py files to work around weird encoding problem
  in Turkish (#283331)- work around problems with multi-line plural specification (#252136)- rebuild against new expat- build against db4.6- add sparc64 to the list of archs for _pyconfig64_h- fix ctypes again on some arches (Hans de Goede, #251637)- link curses modules with ncursesw (#246385)- fix _elementtree.so build (#245703)
- ensure that extension modules we expect are actually built rather than
  having them silently fall out of the package- link with system expat (#245703)- rebuild to take advantage of hardlinking between identical pyc/pyo files- update to python 2.5.1- fix alpha build (#231961)- tcl/tk was reverted; rebuild again- rebuild for new tcl/tk- link with ncurses- fix extensions to use shared libpython (#219564)
- all 64bit platforms need the regex fix (#122304)- fix ctypes to not require execstack (#220669)- don't link against compat-db (Robert Scheck)- fix invalid assert in debug mode (upstream changeset 52622)- obsolete/provide python-ctypes (#219256)- fix atexit traceback with failed syslog logger (#218214)
- split libpython into python-libs subpackage for multilib apps
  embedding python interpreters- disable installation of .egg-info files for now- support db 4.5
- obsolete python-elementtree; since it requires some code tweaks, don't
  provide it
- obsolete old python-sqlite; provide the version that's actually included- fix _md5 and _sha modules (Robert Sheck)
- no longer provide optik compat; it's been a couple of years now
- no longer provide the old shm module; if this is still needed, let's
  build it separately
- no longer provide japanese codecs; should be a separate package- update to 2.5.0 final- Updated to 2.5c1. Merged fixes from FC6 too:
- Fixed bug #199373 (on some platforms CFLAGS is needed when linking)
- Fixed bug #198971 (case conversion not locale safe in logging library)
- Verified bug #201434 (distutils.sysconfig is confused by the change to make
  python-devel multilib friendly) is fixed upstream- Updated to 2.5b2 (which for comparison reasons is re-labeled 2.4.99.b2)- Updated to 2.5b1 (which for comparison reasons is re-labeled 2.4.99.b1)- and fix it for real- fix python-devel on ia64- Fixed python-devel to be multilib friendly (bug #192747, #139911)- Only copying mkhowto from the Docs - we don't need perl dependencies from
  python-tools.- Fixed bug #121198 (webbrowser.py should use the user's preferences first)- Fixed bug #192592 (too aggressive assertion fails) - SF#1257960
- Fixed bug #167468 (Doc/tools not included) - added in the python-tools package- Fixed bug #193484 (added pydoc in the main package)- Added dist in the release- rebuilt to fix broken libX11 dependency- rebuild with new gcc to fix #188649- Updated to 2.4.3- bump again for double-long bug on ppc(64)- rebuilt for newer tix- rebuilt for new gcc4.1 snapshot and glibc changes- fixed #136654 for another instance of audiotest.au- rebuilt- fix build for modular X, remove X11R6 path references- Upgraded to 2.4.2
- BuildRequires autoconf- Rebuilding against newer openssl.
- XFree86-devel no longer exists- Once more -- this time, to fix -EPERM when you run it in a directory
  you can't re�x�������������(��������X�/an?sock��������0KbEsr/b�$r����������������
bEcEaE
�nnis <jdennis@redhat.com> - 1.10.7-1John Dennis <jdennis@redhat.com> - 1.10.6-1John Dennis <jdennis@redhat.com> - 1.10.5-1John Dennis <jdennis@redhat.com> - 1.10.4-1John Dennis <jdennis@redhat.com> - 1.10.3-1John Dennis <jdennis@redhat.com> - 1.10.2-1John Dennis <jdennis@redhat.com> - 1.10.1-1John Dennis <jdennis@redhat.com> - 1.10.0-1John Dennis <jdennis@redhat.com> - 1.9.7-1John Dennis <jdennis@redhat.com> - 1.9.6-1Dan Walsh <dwalsh@redhat.com> - 1.9.5-1Dan Walsh <dwalsh@redhat.com> - 1.9.4-1John Dennis <jdennis@redhat.com> - 1.9.3-1Dan Walsh <dwalsh@redhat.com> - 1.9.2-1Dan Walsh <dwalsh@redhat.com> - 1.9.1-1Dan Walsh <dwalsh@redhat.com> - 1.8.19-1Dan Walsh <dwalsh@redhat.com> - 1.8.18-1Dan Walsh <dwalsh@redhat.com> - 1.8.17-1John Dennis <jdennis@redhat.com> - 1.8.16-1Dan Walsh <dwalsh@redhat.com> - 1.8.15-1John Dennis <jdennis@redhat.com> - 1.8.14-1John Dennis <jdennis@redhat.com> - 1.8.13-1John Dennis <jdennis@redhat.com> - 1.8.12-1John Dennis <jdennis@redhat.com> - 1.8.11-1Dan Walsh <dwalsh@redhat.com> - 1.8.10-1Dan Walsh <dwalsh@redhat.com> - 1.8.9-1Dan Walsh <dwalsh@redhat.com> - 1.8.8-1Dan Walsh <dwalsh@redhat.com> - 1.8.7-1John Dennis <jdennis@redhat.com> - 1.8.6-1John Dennis <jdennis@redhat.com> - 1.8.5-1John Dennis <jdennis@redhat.com> - 1.8.3-1John Dennis <jdennis@redhat.com> - 1.8.1-1Dan Walsh <dwalsh@redhat.com> - 1.7.1-1Dan Walsh <dwalsh@redhat.com> - 1.7-1Dan Walsh <dwalsh@redhat.com> - 1.5-1Dan Walsh <dwalsh@redhat.com> - 1.4-1Dan Walsh <dwalsh@redhat.com> - 1.3-1Dan Walsh <dwalsh@redhat.com> - 1.2-1Dan Walsh <dwalsh@redhat.com> - 1.1-1Dan Walsh <dwalsh@redhat.com> - 1.0-1Dan Walsh <dwalsh@redhat.com> - 0.48-1Dan Walsh <dwalsh@redhat.com> - 0.47-1Dan Walsh <dwalsh@redhat.com> - 0.46-1Dan Walsh <dwalsh@redhat.com> - 0.45-1Dan Walsh <dwalsh@redhat.com> - 0.44-1Dan Walsh <dwalsh@redhat.com> - 0.43-1Dan Walsh <dwalsh@redhat.com> - 0.42-1Dan Walsh <dwalsh@redhat.com> - 0.41-1Dan Walsh <dwalsh@redhat.com> - 0.40-1Dan Walsh <dwalsh@redhat.com> - 0.39-1Dan Walsh <dwalsh@redhat.com> - 0.38-1Dan Walsh <dwalsh@redhat.com> - 0.37-1John Dennis <jdennis@redhat.com> - 0.36-1John Dennis <jdennis@redhat.com> - 0.35-1Dan Walsh <dwalsh@redhat.com> - 0.34-1Dan Walsh <dwalsh@redhat.com> - 0.33-1Dan Walsh <dwalsh@redhat.com> - 0.32-1Dan Walsh <dwalsh@redhat.com> - 0.31-1John Dennis <jdennis@redhat.com> - 0.30-1Dan Walsh <dwalsh@redhat.com> - 0.29-1Dan Walsh <dwalsh@redhat.com> - 0.28-1John Dennis <jdennis@redhat.com> - 0.27-1Dan Walsh <dwalsh@redhat.com> - 0.26-1Dan Walsh <dwalsh@redhat.com> - 0.25-1Dan Walsh <dwalsh@redhat.com> - 0.24-1John Dennis <jdennis@redhat.com> - 0.23-1Dan Walsh <dwalsh@redhat.com> - 0.20-1Dan Walsh <dwalsh@redhat.com> - 0.19-1Dan Walsh <dwalsh@redhat.com> - 0.18-1Dan Walsh <dwalsh@redhat.com> - 0.17-1Dan Walsh <dwalsh@redhat.com> - 0.16-1Dan Walsh <dwalsh@redhat.com> - 0.15-1Dan Walsh <dwalsh@redhat.com> - 0.13-1Dan Walsh <dwalsh@redhat.com> - 0.12-1John Dennis <jdennis@redhat.com> - 0.11-1Dan Walsh <dwalsh@redhat.com> - 0.10-1Dan Walsh <dwalsh@redhat.com> - 0.9-1Dan Walsh <dwalsh@redhat.com> - 0.8-1Dan Walsh <dwalsh@redhat.com> - 0.7-1John Dennis <jdennis@redhat.com> - 0.3-1John Dennis <jdennis@redhat.com> - 0.2-1John Dennis <jdennis@redhat.com> - 0.1-1- Fix shebang of SetroubleshootPrivileged.py (#2231023)
- Check that SELinux is enabled before running (#2178950)- Shutdown RunFaultServer nicely (#2119001)- Decrease setroubleshootd priority and limit RAM utilization to 1GB (#2064727)
- doc: Document performance related changes- Update translations (#2017299)- Improve after_first email filter behavior (#2050734)- Revert "Replace pydbus with dasbus"
- Fix typos in --help, man pages and developer's guide (#2028226)
- Do not use Python slip package
- Stop SetroubleshootFixit after 10 seconds of inactivity
- Fix plugin exception reporting
- export alert dbus signal
- Make sure local_policy_package is not None
- sealert: add "Last Seen" column to alert list- Update translations (#1962030)- s�x����������������������X�sh�?man/Э
�<�Wall�$I����������������
���
�age, and require net-tools, which used to provide the
  command, everywhere- skip the setfscreatecon() if fopen() is passed "rb" as the open mode (part
  of #819115)- have -server require /usr/share/dict/words, which we set as the default
  dict_file in kdc.conf (#817089)- change back dns_lookup_kdc to the default setting (Stef Walter, #805318)
- comment out example.com examples in default krb5.conf (Stef Walter, #805320)- update to 1.10.1
  - drop the KDC crash fix
  - drop the KDC lookaside cache fix
  - drop the fix for kadmind RPC ACLs (CVE-2012-1012)- when removing -workstation, remove our files from the info index while
  the file is still there, in %preun, rather than %postun, and use the
  compressed file's name (#801035)- Fix string RPC ACLs (RT#7093); CVE-2012-1012- Add upstream lookaside cache behavior fix (RT#7082)- add patch to accept keytab entries with vno==0 as matches when we're
  searching for an entry with a specific name/kvno (#230382/#782211,RT#3349)- update to 1.10 final- Add upstream crashfix patch (RT#7081)- update to beta 1- mktemp was long obsoleted by coreutils- modify the deltat grammar to also tell gcc (4.7) to suppress
  "maybe-uninitialized" warnings in addition to the "uninitialized" warnings
  it's already being told to suppress (RT#7080)- update to alpha 2
- drop a couple of patches which were integrated for alpha 2- pull in patch for RT#7046: tag a ccache containing credentials obtained via
  S4U2Proxy with the principal name of the proxying principal (part of #761317)
  so that the default principal name can be set to that of the client for which
  it is proxying, which results in the ccache looking more normal to consumers
  of the ccache that don't care that there's proxying going on
- pull in patch for RT#7047: allow tickets obtained via S4U2Proxy to be cached
  (more of #761317)
- pull in patch for RT#7048: allow PAC verification to only bother trying to
  verify the signature with keys that it's given (still more of #761317)- apply upstream patch to fix a null pointer dereference when processing
  TGS requests (CVE-2011-1530, #753748)- correct a bug in the fix for #754001 so that the file creation context is
  consistently reset- update to 1.10 alpha 1
- on newer releases where we can assume NSS >= 3.13, configure PKINIT to build
  using NSS
- on newer releases where we build PKINIT using NSS, configure libk5crypto to
  build using NSS
- rename krb5-pkinit-openssl to krb5-pkinit on newer releases where we're
  expecting to build PKINIT using NSS instead
- during %check, run check in the library and kdc subdirectories, which
  should be able to run inside of the build system without issue- Rebuilt for glibc bug#747377- apply upstream patch to fix a null pointer dereference with the LDAP kdb
  backend (CVE-2011-1527, #744125), an assertion failure with multiple kdb
  backends (CVE-2011-1528), and a null pointer dereference with multiple kdb
  backends (CVE-2011-1529) (#737711)- pull in patch from trunk to rename krb5int_pac_sign() to krb5_pac_sign() and
  make it public (#745533)- kadmin.service: fix #723723 again
- kadmin.service,krb5kdc.service: remove optional use of $KRB5REALM in command
  lines, because systemd parsing doesn't handle alternate value shell variable
  syntax
- kprop.service: add missing Type=forking so that systemd doesn't assume simple
- kprop.service: expect the ACL configuration to be there, not absent
- handle a harder-to-trigger assertion failure that starts cropping up when we
  exit the transmit loop on time (#739853)- hardcode pid file as option in krb5kdc.service- fix pid path in krb5kdc.service- convert to systemd- pull in upstream patch for RT#6952, confusion following referrals for
  cross-realm auth (#734341)
- pull in build-time deps for the tests- switch to the upstream patch for #727829- handle an assertion failure that starts cropping up when the patch for
  using poll (#701446) meets servers that aren't running KDCs or against
  which the connection fails for other reasons (#727829, #734172)�x���������������������X�H?��������h�������Ş%�$U����������������
ŞĞƞ
�g_file.so plugin- Fix for centos6 to write temp pass into log file instead of stdout (#1541769)- Re-added TokuBackup to the packaging (JEN-439)- Initial release PS 5.7.10-1rc1- Updated for 5.7.9
- Added libtest_* plugins to test package subpackage
- Add mysqlpump man page
- Obsolete mysql-connector-c-shared dependencies- Add support for pkg-config- Added libtest_framework.so, libtest_services.so, libtest_services_threaded.so plugins
- Build and ship mecab plugin- Include boost sources
- Fix cmake buildrequires
- Fix build on el5 with gcc44
- Add license info in each subpackage
- Soname bump, more compat packages
- Updated default shell for mysql user
- Added mysql_ssl_rsa_setup
- Include mysql-files directory- Provide replication_observers_example_plugin.so plugin- Updated for 5.7.6- Provide mysql_no_login.so plugin- Provide mysql-compat-server dependencies- Remove perl(GD) and dtrace dependencies- Resolve embedded-devel conflict issue- Add bench package
- Enable dtrace- Updated for 5.7.5- Fix Cflags for el7- Support for enterprise packages
- Upgrade from MySQL-* packages- Resolve conflict with mysql-libs-compat- Resolve conflict issues during upgrade
- Add ha_example.so plugin which is now included- 5.7.4
- Enable shared libmysqld by cmake option
- Move mysqltest and test plugins to test subpackage- Fixed isa_bits error- Initial 5.7 port- Fixed uln advanced rpm libyassl.a error
- Updated to 5.6.15- Fixed mysql_install_db usage 
- Improved handling of plugin directory- Refresh mysql-install patch and service renaming- Updated to 5.6.14- Support upgrade from 5.5 ULN packages to 5.6- Enhanced perl filtering 
- Added openssl-devel to buildreq- Removed mysql_embedded binary to resolve multilib conflict issue- Fixed Provides and Obsoletes issues in server, test packages- Updated to 5.6.13- Added files list to embedded packages- Updated libmysqld.a with libmysqld.so in embedded package- Updated test package dependency from client to server- Added libs-compat dependency under libs package to resolve server
  installation conflicts issue.- Removed libmysqlclient.so.16 from libs package- Adjusted to work on OEL6- Move libs to mysql/
- Basic multi arch support
- Fix changelog dates- Major cleanup- Updated to 5.6.12- Allow to override the default to use the bundled yaSSL by an option like
      --define="with_ssl /path/to/ssl"- Replace old my-*.cnf config file examples with template my-default.cnf- Let the installation use the new option "--random-passwords" of "mysql_install_db".
  (Bug# 12794345 Ensure root password)
- Fix an inconsistency: "new install" vs "upgrade" are told from the (non)existence
  of "$mysql_datadir/mysql" (holding table "mysql.user" and other system stuff).- Add a macro "runselftest":
  if set to 1 (default), the test suite will be run during the RPM build;
  this can be oveeridden via the command line by adding
      --define "runselftest 0"
  Failures of the test suite will NOT make the RPM build fail!- Add the man page for the "mysql_config_editor".- Make sure newly added "SPECIFIC-ULN/" directory does not disturb packaging.- Removal all traces of the readline library from mysql (BUG 13738013)- Fix duplicate mentioning of "mysql_plugin" and its manual page,
  it is better to keep alphabetic order in the files list (merging!).- Let the RPM capabilities ("obsoletes" etc) ensure that an upgrade may replace
  the RPMs of any configuration (of the current or the preceding release series)
  by the new ones. This is done by not using the implicitly generated capabilities
  (which include the configuration name) and relying on more generic ones which
  just list the function ("server", "client", ...).
  The implicit generation cannot be prevented, so all these capabilities must be
  explicitly listed in "Obsoletes:"- Add support for Oracle Linux 6 and Red Hat Enterprise Linux 6.  Due to
  changes in RPM behaviour ($RPM_BUILD_ROOT is removed prior to install)
  this necessitated a move of the libmygcc.a installation to the install
  phase,�x����������������������X�
�?
0t@}M�
�$]����������������
M�N�

��&g��_{Д
�	�-�Ɠ%{-�t���Rܰ�d4a24380d2272bb199ae570b15d9977c637709881c7c9ae201c7046e78d375ca3129165fd1dae1e9cc586ac9a5934739684178adf���Tdf���/vmalloc: Avoid rare case of flushing TLB with weird arguments (Don Dutile) [1738631]
- [mm] mm/vmalloc: Fix calculation of direct map addr range (Don Dutile) [1738631]
- [mm] mm/vmalloc: Add flag for freeing of special permsissions (Don Dutile) [1738631]
- [x86] x86/mm/cpa: Add set_direct_map_*() functions (Don Dutile) [1738631]
- [arm64] dma-mapping: add a kconfig symbol for arch_setup_dma_ops availability (Don Dutile) [1738631]
- [iommu] iommu/dma: Remove the flush_page callback (Don Dutile) [1738631]
- [include] iommu/dma: Cleanup dma-iommu.h (Don Dutile) [1738631]
- [dma] dmaengine: Add matching device node validation in __dma_request_channel() (Don Dutile) [1738631]
- [dma] dmaengine: dma_request_chan_by_mask() to handle deferred probing (Don Dutile) [1738631]
- [include] dma-buf: start caching of sg_table objects v2 (Don Dutile) [1738631]
- [kernel] dma-mapping: add a Kconfig symbol to indicate arch_dma_prep_coherent presence (Don Dutile) [1738631]
- [iommu] iommu/dma-iommu: Remove iommu_dma_map_msi_msg() (Don Dutile) [1738631]
- [irqchip] irqchip/ls-scfg-msi: Don't map the MSI page in ls_scfg_msi_compose_msg() (Don Dutile) [1738631]
- [irqchip] irqchip/gic-v3-mbi: Don't map the MSI page in mbi_compose_m{b, s}i_msg() (Don Dutile) [1738631]
- [irqchip] irqchip/gicv2m: Don't map the MSI page in gicv2m_compose_msi_msg() (Don Dutile) [1738631]
- [irqchip] irqchip/gic-v3-its: Don't map the MSI page in its_irq_compose_msi_msg() (Don Dutile) [1738631]
- [irqchip] irqchip/gic-v3-its: Align PCI Multi-MSI allocation on their size (Don Dutile) [1738631]
- [iommu] iommu/dma-iommu: Split iommu_dma_map_msi_msg() in two parts (Don Dutile) [1738631]
- [iommu] iommu/dma: Remove unused variable (Don Dutile) [1738631]
- [iommu] iommu/dma: Use NUMA aware memory allocations in __iommu_dma_alloc_pages() (Don Dutile) [1738631]
- [kernel] genirq/msi: Add a new field in msi_desc to store an IOMMU cookie (Don Dutile) [1738631]
- [pci] PCI/MSI: Remove unused mask_msi_irq() and unmask_msi_irq() (Don Dutile) [1738631]
- [include] PCI/MSI: Remove unused __write_msi_msg() and write_msi_msg() (Don Dutile) [1738631]
- [include] genirq/msi: Clean up usage of __u8/__u16 types (Don Dutile) [1738631]
- [base] platform-msi: Free descriptors in platform_msi_domain_free() (Don Dutile) [1738631]
- [base] genirq/msi: Allow creation of a tree-based irqdomain for platform-msi (Don Dutile) [1738631]
- [kernel] dma-debug: only skip one stackframe entry (Don Dutile) [1738631]
- [dma] dmaengine: idma64: Move driver name to the header (Don Dutile) [1738631]
- [kernel] dma-mapping: remove an unnecessary NULL check (Don Dutile) [1738631]
- [include] dma-buf: Update [un]map documentation to match the other functions (Don Dutile) [1738631]
- [include] dma-buf: Remove leftover [un]map_atomic comments (Don Dutile) [1738631]
- [x86] x86/dma: Remove the x86_dma_fallback_dev hack (Don Dutile) [1738631]
- [kernel] dma-mapping: remove leftover NULL device support (Don Dutile) [1738631]
- [kernel] dma: select GENERIC_ALLOCATOR for DMA_REMAP (Don Dutile) [1738631]
- [crypto] crypto: ccp - Ignore unconfigured CCP device on suspend/resume (Gary Hook) [1743999]
- [md] dm snapshot: fix oversights in optional discard support (Mike Snitzer) [1744291]
- [md] dm snapshot: add optional discard support features (Mike Snitzer) [1744291]
- [md] dm snapshot: Use fine-grained locking scheme (Mike Snitzer) [1744291]
- [md] dm snapshot: Make exception tables scalable (Mike Snitzer) [1744291]
- [md] dm snapshot: Replace mutex with rw semaphore (Mike Snitzer) [1744291]
- [md] dm snapshot: Don't sleep holding the snapshot lock (Mike Snitzer) [1744291]
- [include] list_bl: Add hlist_bl_add_before/behind helpers (Mike Snitzer) [1744291]
- [powerpc] powerpc/rtas: use device model APIs and serialization durin�x�������������z�������X�su�	?t to��������,5ulne�$<����������������
,5+5-5
�dbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlw�x�������������pi�������X�xeO?g #1����������"mnsaf�$2����������������
"m#m!m
�1_0)(64bit)libcurl.so.4()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)pcre2(x86-64)php74-php-json(x86-64)php74-runtimerpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)tzdata7.4.33-10.el8.remi10.327.4.33-10.el8.remi3.0.4-14.6.0-14.0-15.2-14.14.3exK@e0@d��d�d9@@c�@c�w�c�R@ca
@cY!@c47@b�=�bUi�b�@b��a��a��@a�c�a��@a�b�a�y�aw�ap�a]��aI�@a8��a$�@aj@a
F�`�@`�@`��`�r�`���`��@`�7@`���`u��`P��`>(�`+��`>�`�@`�_�T�_إ@_�j�_���_��@_��_���_s!�_`��_N7�_;�_)M�_�_�_c�_@^��^�y�^��^��^���^�l@^���^�0�^p��^^F�^K�^9\�^0"@^&�^r�]��]��@]�e@]�M@]�)�]��]��@]�@�]���]���]�n�]�@]�(�]�4@]�?�]��@]��]��]nU�][�]Ik�]8H@]6��](v@]$��]�]��]�@]�@]�@\���\�t@\�"�\�9�\��@\��@\�\�@\ڭ�\Ɋ@\Ɋ@\��\�C@\��@\�N�\�|�\��\~d�\o�@\k�\j�@\\�\Yz�\G�\@n@\?�\4��\�@\l@[�@[�@[�0�[�
@[��@[�#@[��@[�"@[�9@[�9@[ug@[M�@[;e@[+�@[(�@[@[�[W�Z�z@Z�(�Z�@Z��Z�l�Z�2@Z�`@Z��@Z�<�Z���Z�$�Z�$�Zp^@Z]�@ZL�ZF.@Z1@ZO�Z
�@Y�+@Y�B@Yܶ@Y��@Y�A@Y��Y�o@Y��Y��@Y�W@Y��Y��@Y��Y��@Y�m@Y�m@Ym�@Yd��Y[�@YI@Y6�@Y1S@Y,
@Y,
@Y�Y
��X�:@X��X��@X�P@X��@X•@X�f@X�B�X�@X��XX�XX�XX�Xn5@Xa@X@�X#�X��X�@W��@W�@W�;�W�@W��W��@W|�Wu	�Wj}�Wj}�WX�WE��W4p@W!�@W ��W�@W�@V���V�J�V��V��VŲ@V��V�T@V�T@V�v�V�
�V�VqR@Vh�V`.�V]��V\:@VU��VD@VC-�V0��V$�@VC�V�@V�U���U�Y�U�U�d@U���U���U��U���U�a@Uyx@Uv�@Um��UhT�Uc�UY�@UW1@U?v@U?v@U>$�U2G@U/�@U��U�@U�@U�@U�@U
�@T�9�T��@T���T�C@T��T�p@T�5�Tw@Tu��Th��Td�@TV�T?�@T.��Tk@S��S��Sr	@S,)�S?�S��R�@R��@R��@R�R�R�R�R_�@R:�@R��Q��@Q�Y@Q�Y@Q��Q��Q��@Q��@Q��Qy�Qf��Q@j@P��@PѬ@P��P�@P�@P�*�P��@P��@P�)�P�)�P���P���P���P���P���P�5@P{��Px@Pl(�Pj�@Pi��Pi��Pe�@P`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F
@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[
@E[
@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B�B	�@A�@A��A��A�_�A�_�A�_�AJ�AJ�AJ�A@E�A
@Ag@Remi Collet <remi@remirepo.net> - 7.4.33-10Remi Collet <remi@remirepo.net> - 7.4.33-9Remi Collet <remi@remirepo.net> - 7.4.33-8Remi Collet <remi@remirepo.net> - 7.4.33-7Remi Collet <remi@remirepo.net> - 7.4.33-6Remi Collet <remi@remirepo.net> - 7.4.33-5Remi Collet <remi@remirepo.net> - 7.4.33-4Remi Collet <remi@remirepo.net> - 7.4.33-2Remi Collet <remi@remirepo.net> - 7.4.33-1Remi Collet <remi@remirepo.net> - 7.4.32-2Remi Collet <remi@remirepo.net> - 7.4.32-1Remi Collet <remi@remirepo.net> - 7.4.30-1Remi Collet <remi@remirepo.net> - 7.4.29-1Remi Collet <remi@remirepo.net> - 7.4.28-2Remi Collet <remi@remirepo.net> - 7.4.28-1Remi Collet <remi@remirepo.net> - 7.4.27-1Remi Collet <remi@remirepo.net> - 7.4.27~RC1-2Remi Collet <remi@remirepo.net> - 7.4.27~RC1-1Remi Collet <remi@remirepo.net> - 7.4.26-1Remi Collet <remi@remirepo.net> - 7.4.26~RC1-2Remi Collet <remi@remirepo.net> - 7.4.26~RC1-1Remi Collet <remi@remirepo.net> - 7.4.25-2Remi Collet <remi@remirepo.net> - 7.4.25-1Remi Collet <remi@remirepo.net> - 7.4.25~RC1-1Remi Collet <remi@remirepo.net> - 7.4.24-1Remi Collet <remi@remirepo.net> - 7.4.24~RC1-1Remi Collet <remi@remirepo.net> - 7.4.23-1Remi Collet <remi@remirepo.net> - 7.4.23~RC1-1Remi Collet <remi@remirepo.net> - 7.4.22-1Remi Collet <remi@remirepo.net> - 7.4.22~RC1-1Remi Collet <remi@remirepo.net> - 7.4.21-1Remi Collet <remi@remirepo.net> - 7.4.21~RC1-1Remi Collet <remi@remirepo.net> - 7.4.20-1Remi Collet <remi@remirepo.net> - 7.4.20~RC1-2Remi Collet <remi@remirepo.net> - 7.4.20~RC1-1Remi Collet <remi@remirepo.net> - 7.4.19-1Remi Collet <remi@remirepo.net> - 7.4�x��������������X�������X�tr�?ed
 ����
5#534�$����������������
555
�F 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=007df4d97fe6d684a784abbcb713cc26849c48eb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=db159f0589eda9f36b301e4730a558c7e31fbdb9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a2429406d8d4216e1684447f42082a413add0177, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e07c4a55a0a940c438e8f455591471640b500f30, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e6c07d43cbd1101448c3bf83322c5d59520f0dd0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=054e13152667867d04e29c978ee54f223e2e5be7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e1578fb2e7aa3fb1c82ea5d2be9480afba6104e8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=55f3b5efa4fa277d3e139b7a144f4e51df350003, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e28bdb7ab60c291a62111e01ce4183ffc9c04029, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8633a83dffdddbbc470816b7283dae30d10f902b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fed13fa3ea8e517f6ef617fd3913c63051fc6c2f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=200ffe99430078b8febe0203770c8c5e62b7eac4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4292c5468b09f691fbf6946b129634f209937cf7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=19bb1914e8dacbcdf496a1e1539eb27122b8be44, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=391c803890f5b8ae2218aea893b05d98f063658f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e02b7259c2eadc4c613e608a137cafb6cae35252, strippedELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=bb5a384dbb93917f8fe9ce1441ebbdcd08f87eaf, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=67f1750b2ca04763a8866a74f257733f2b1695e7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d5a1c53e288ec55d7c361361d58bcfcd8627ae88, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0be94d5de9a7ce1190834018de8c8867e977fa79, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2cf0e1e23a7632d9b14f11ef5aec82b6ee4d8f53, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1782d4bad764376a8ba20db2acaf0dedf6b68c37, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d44adf9c7b4466fa16447e0812765c6b6e004e97, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ed663d5c3912c060d58a0d27571fce734bc5cabb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d5fbeeb598731bc2288bfa068c0e6a5cb6ed1c29, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=59c2d11f0c749f25178e9375471f282aa768e4fe, strippedELF 64-bit LSB executable, x86-64, version 1 (GNU/Linux), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f3b12785b2c70086d7f04b471055d9133b084798, strippedELF 64-bit LSB executable, x86-64, version 1 (GNU/Linux), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3d2850dc5fdd42b5e1a5893a039f0da9a4054df9, �x�������������`H�������X�t�?w sn��	h�rt h�$����������������


�RRRRR
RRR1R#RRRRRR1R RRRRR
RRR1R R#RRRRRR
RRR1R RRRRRR
RRR1R	RRRR R#RR
RRRR1R-RR R#RRRRRRR
RR,RR1RR R$R#RRRRRRR
RRR1RR R#RRRRR
RRR1RR RRRRR
RRR1RR R#R
RRRRRR
RR1RR R%R#RRRRR
RRR1RRRR R#R&RR
RRR1R#R RRRRR
RRR1RRRRRRRRR RR#R&RR
RR)RR1RR R#RRRR
RRR1RRRRR
RRR1R#R RRR
RRR1RR!R RR#RRRRRRR
RRR)RR1RRRR R#RR
RRR1R RRRRRR)R
RR1RR R#RRRRRR
RRR1R RR#RRRRRRR)R
RR1RR R#RRRRRR
RR)RR1RRRR R#RR
RRR1R RRRRRR
RRR1R RR#RRRRR
RRR1R#R R$RRRRRR
RRR1R#RR RRRRRR
RRR1R RR#RRRR
RRR1RR R#RRRRR
RRR1RRR!R RR#R&RRRRRR+RR
RRR)RR*RR1RR RRRRRRRR
RRR1R RR#RRRRR
RRR1RR RRRR
RRR1RRRR R#RR
RRR1RRRRRR RR%R#R&RR
RR)RR1R#R RRRRRRRR
RR1R R#RRRRRR1R RRRRRRRR1R RRRRRR1RRRRRRRR1RRRRRRR)R
RR1RRRRRRR)RR1https://bugs.rockylinux.orgcracklib-dicts2.8utf-8f8672a3e83c1894876dd9b561200f6a56a457ed1effca35acdeca39e8ec86e3a?�������#�.�#�d��W{�/��3
!pQ�p�)�Tξ7��]�mtZ`iC
�
	�]�mtZ`��3�HP,s*p�,������=��Dc9��zM?"l�?d�3�dP�r�K�뼃W��Ch�u����:��ze5���6\��8G��P1��fU_�b�`��B&߈���a��5R~�8f�^N�kcחԓU��@�=+���9ۦ�k��JC���@'��Q��:���iV���_�m�@n�B��F�$)Zpf'r��.]Jh9�+SN�y���c��߾��
�x�V�h\��f�A"��/�m5�Y/��/Q��$�o�
�m���8|n�GbT9���?R�����xĈ���r��)�k�����~ٔn�hwj�9J��cҞ��C�3
���4����p!� �~��=Č-�N��%!
�!%��}/�N�хk���
��f�h6'��Œ�M
d	H��ts.�����U�~�'��p�ٽ����ڭ�����.)�A�N3H����n�R�]�c5�����\�S�#Y��TEg��`>�G�r��?��[���$�(ed621d98440c4626c172634d11ea0fced36d9a65030432649a438c6b24a9ff2bd0ce5b43e6e9fabb2d418172c677dd07ff7b3b1ciZ�
)��iZ�	 re-enable mod_asis due to popular demand (#1284315)- fix crash when using -X argument (#1272234)- rebase socket activation patch to 2.4.17- update to 2.4.17 (#1271224)
- build, load mod_http2
- don't build mod_asis, mod_file_cache
- load mod_cache_socache, mod_proxy_wstunnel by default
- check every built mod_* is configured
- synch ssl.conf with upstream; disable SSLv3 by default- update to 2.4.16- mod_ssl: use "localhost" in the dummy SSL cert if len(FQDN) > 59 chars- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- update to 2.4.12- fix compilation with lua-5.3- remove filter for auto-provides of httpd modules, it is not needed since F20- core: fix bypassing of mod_headers rules via chunked requests (CVE-2013-5�x��������������7�������X�no�	?acto���E������15isab�$!����������������
150525
�slwdbadmin-python3-1.0.2-22.el8.src.rpm�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������@'�������X�br�?() t�v�|�new �$_����������������
���
� but has to be broken at some point to work correctly with
  unpatched versions built with newer versions of glibc)- bump release number and rebuild- add patch to fix telnetd vulnerability- tweak statglue.c to fix stat/stat64 aliasing problems
- be cleaner in use of gcc to build shlibs- use gcc to build shared libraries- add patch to support "ANY" keytab type (i.e.,
  "default_keytab_name = ANY:FILE:/etc/krb5.keytab,SRVTAB:/etc/srvtab"
  patch from Gerald Britton, #42551)
- build with -D_FILE_OFFSET_BITS=64 to get large file I/O in ftpd (#30697)
- patch ftpd to use long long and %lld format specifiers to support the SIZE
  command on large files (also #30697)
- don't use LOG_AUTH as an option value when calling openlog() in ksu (#45965)
- implement reload in krb5kdc and kadmind init scripts (#41911)
- lose the krb5server init script (not using it any more)- Bump release + rebuild.- pass some structures by address instead of on the stack in krb5kdc- rebuild in new environment- add patch from Tom Yu to fix ftpd overflows (#37731)- disable optimizations on the alpha again- add in glue code to make sure that libkrb5 continues to provide a
  weak copy of stat()- build alpha with -O0 for now- fix the kpropd init script- update to 1.2.2, which fixes some bugs relating to empty ETYPE-INFO
- re-enable optimization on Alpha- build alpha with -O0 for now
- own %{_var}/kerberos- own the directories which are created for each package (#26342)- gettextize init scripts- add some comments to the ksu patches for the curious
- re-enable optimization on alphas- fix krb5-send-pr (#18932) and move it from -server to -workstation
- buildprereq libtermcap-devel
- temporariliy disable optimization on alphas
- gettextize init scripts- force -fPIC- rebuild in new environment- add bison as a BuildPrereq (#20091)- change /usr/dict/words to /usr/share/dict/words in default kdc.conf (#20000)- apply kpasswd bug fixes from David Wragg- make krb5-libs obsolete the old krb5-configs package (#18351)
- don't quit from the kpropd init script if there's no principal database so
  that you can propagate the first time without running kpropd manually
- don't complain if /etc/ld.so.conf doesn't exist in the -libs %post- fix credential forwarding problem in klogind (goof in KRB5CCNAME handling)
  (#11588)
- fix heap corruption bug in FTP client (#14301)- fix summaries and descriptions
- switched the default transfer protocol from PORT to PASV as proposed on
  bugzilla (#16134), and to match the regular ftp package's behavior- rebuild to compress man pages.- move initscript back- disable servers by default to keep linuxconf from thinking they need to be
  started when they don't- automatic rebuild- change cleanup code in post to not tickle chkconfig
- add grep as a Prereq: for -libs- move condrestarts to postun
- make xinetd configs noreplace
- add descriptions to xinetd configs
- add /etc/init.d as a prereq for the -server package
- patch to properly truncate $TERM in krlogind- update to 1.2.1
- back out Tom Yu's patch, which is a big chunk of the 1.2 -> 1.2.1 update
- start using the official source tarball instead of its contents- Tom Yu's patch to fix compatibility between 1.2 kadmin and 1.1.1 kadmind
- pull out 6.2 options in the spec file (sonames changing in 1.2 means it's not
  compatible with other stuff in 6.2, so no need)- tweak graceful start/stop logic in post and preun- update to the 1.2 release
- ditch a lot of our patches which went upstream
- enable use of DNS to look up things at build-time
- disable use of DNS to look up things at run-time in default krb5.conf
- change ownership of the convert-config-files script to root.root
- compress PS docs
- fix some typos in the kinit man page
- run condrestart in server post, and shut down in preun- only remove old krb5server init script links if the init script is there- disable kshell and eklogin by default- patch mkdir/rmdir problem in ftpcmd.y
- add condrestart option to init script
- split the server init script into three pieces and �x���������������������X
2-m?e Or����������
�*
om> �$>����������������
�*
�*
�*

�ction re-use (CVE-2022-22576)- fix STARTTLS protocol injection via MITM (CVE-2021-22947)
- fix protocol downgrade required TLS bypass (CVE-2021-22946)- fix TELNET stack contents disclosure again (CVE-2021-22925)
- fix TELNET stack contents disclosure (CVE-2021-22898)
- fix bad connection reuse due to flawed path name checks (CVE-2021-22924)
- disable metalink support to fix the following vulnerabilities
    CVE-2021-22923 - metalink download sends credentials
    CVE-2021-22922 - wrong content via metalink not discarded- fix a cppcheck's false positive in 0029-curl-7.61.1-CVE-2021-22876.patch- make `curl --head file://` work as expected (#1947493)
- prevent automatic referer from leaking credentials (CVE-2021-22876)- http: send payload when (proxy) authentication is done (#1918692)
- curl: Inferior OCSP verification (CVE-2020-8286)
- libcurl: FTP wildcard stack overflow (CVE-2020-8285)
- curl: trusting FTP PASV responses (CVE-2020-8284)- validate an ssl connection using an intermediate certificate (#1895355)- fix multiarch conflicts in libcurl-minimal (#1895391)- do not crash when HTTPS_PROXY and NO_PROXY are used together (#1873327)
- libcurl: wrong connect-only connection (CVE-2020-8231)- avoid overwriting a local file with -J (CVE-2020-8177)- load built-in openssl engines (#1854369)- double free due to subsequent call of realloc() (CVE-2019-5481)
- fix heap buffer overflow in function tftp_receive_packet() (CVE-2019-5482)
- fix TFTP receive buffer overflow (CVE-2019-5436)- rebuild with updated annobin to prevent Execshield RPMDiff check from failing- fix SMTP end-of-response out-of-bounds read (CVE-2019-3823)
- fix NTLMv2 type-3 header stack buffer overflow (CVE-2019-3822)
- fix NTLM type-2 out-of-bounds buffer read (CVE-2018-16890)
- xattr: strip credentials from any URL that is stored (CVE-2018-20483)- do not let libssh create a new socket for SCP/SFTP (#1669156)- curl -J: do not append to the destination file (#1660827)- make the patch for CVE-2018-16842 apply properly (CVE-2018-16842)- SASL password overflow via integer overflow (CVE-2018-16839)
- fix use-after-free in handle close (CVE-2018-16840)
- fix bad arethmetic when outputting warnings to stderr (CVE-2018-16842)- enable TLS 1.3 post-handshake auth in OpenSSL (#1636900)- make the built-in manual compressed again (#1620217)- update the documentation of --tlsv1.0 in curl(1) man page (#1620217)- enforce versioned libpsl dependency for libcurl (#1631804)- test320: update expected output for gnutls-3.6.4
- new upstream release (#1625677)- ssl: set engine implicitly when a PKCS#11 URI is provided (#1219544)- relax crypto policy for the test-suite to make it pass again (#1611712)- disable flaky test 1900, which covers deprecated HTTP pipelining
- adapt test 323 for updated OpenSSL- rebuild against against brotli-1.0.5- new upstream release, which fixes the following vulnerability
    CVE-2018-0500 - SMTP send heap buffer overflow- enable support for brotli compression in libcurl-full- do not hard-wire path of the Python 3 interpreter- new upstream release, which fixes the following vulnerabilities
    CVE-2018-1000300 - FTP shutdown response buffer overflow
    CVE-2018-1000301 - RTSP bad headers buffer over-read- make the test-suite use Python 3- ftp: fix typo in recursive callback detection for seeking- new upstream release, which fixes the following vulnerabilities
    CVE-2018-1000120 - FTP path trickery leads to NIL byte out of bounds write
    CVE-2018-1000121 - LDAP NULL pointer dereference
    CVE-2018-1000122 - RTSP RTP buffer over-read- http2: mark the connection for close on GOAWAY- Add explicity-used build requirements
- Fix libcurl soname version number in %files list to avoid accidental soname
  bumps- switch to %ldconfig_scriptlets
- drop legacy BuildRoot: and Group: tags
- enforce versioned libssh dependency for libcurl- drop temporary workaround for #1540549- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- temporarily work around internal compiler error on x86_64 (�x���������������������X

om�?1.15H{�������"�������4 <rh�$d����������������
�4�4�4
�@@@@@@@@@@







@/bin/bash/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/usr/bin/perlPercona-Server-client-57Percona-Server-shared-57config(Percona-Server-server-57)coreutilsgrepld-linux-x86-64.so.2()(64bit)ld-linux-x86-64.so.2(GLIBC_2.3)(64bit)libaio.so.1()(64bit)libaio.so.1(LIBAIO_0.1)(64bit)libaio.so.1(LIBAIO_0.4)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.16)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libc.so.6(GLIBC_2.9)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(XCRYPT_2.0)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libcurl.so.4()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgcc_s.so.1(GCC_3.3.1)(64bit)libgcc_s.so.1(GCC_3.4)(64bit)libgcc_s.so.1(GCC_4.0.0)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libnuma.so.1()(64bit)libnuma.so.1(libnuma_1.1)(64bit)libnuma.so.1(libnuma_1.2)(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libpthread.so.0(GLIBC_2.3.3)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)librt.so.1(GLIBC_2.3.3)(64bit)libsasl2.so.3()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libssl.so.1.1(OPENSSL_1_1_0d)(64bit)libssl.so.1.1(OPENSSL_1_1_1)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(CXXABI_1.3.2)(64bit)libstdc++.so.6(CXXABI_1.3.5)(64bit)libstdc++.so.6(CXXABI_1.3.8)(64bit)libstdc++.so.6(CXXABI_1.3.9)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.11)(64bit)libstdc++.so.6(GLIBCXX_3.4.15)(64bit)libstdc++.so.6(GLIBCXX_3.4.18)(64bit)libstdc++.so.6(GLIBCXX_3.4.20)(64bit)libstdc++.so.6(GLIBCXX_3.4.21)(64bit)libstdc++.so.6(GLIBCXX_3.4.9)(64bit)libtirpc.so.3()(64bit)libtirpc.so.3(TIRPC_0.3.0)(64bit)libz.so.1()(64bit)libz.so.1(ZLIB_1.2.0)(64bit)net-toolsopensslprocpsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)shadow-utilssystemdsystemdsystemd5.7.32-35.1.el83.0.4-14.6.0-14.0-15.2-1Percona-SQL-server-50Percona-Server-server-51Percona-Server-server-55Percona-Server-server-564.14.2Y���W�@W��V�@V�w�V��@Vii@V
}@U��@U\w@Tи@T�@T�@S�S��S�.�S�@S���SX��SB�@S9X�S L@Sc@R��R�
@Rj]@Rj]@R^�REs@R6�R' �R��R��R@Rq@Q���Q�M�Q�Y@Q�Q�@Qֵ@Q��Q��Q��P��@Puc@Pn�P�@P@O��ON@N�@Np�@NoE�NoE�Nh�@N\�N\�NNP@NE�N-Z�N(�N��MR��MF�@L�LΫ�L�d�Lb��Lk@L�@K�@K���K�[�K��@K���K��@KuB�KK�K2@K
>�J�1@J��@J��J�u@J���J��@J�:�I-�I�@I�@H��H��@G��@G�@G�s@F8}@F��F
@E�{@E��E�=�E���E�<�En�E\R�EX^@D��Do�Da�DU�@DR�D<�D;�@D.k@D
u�D$@C��@C�t�C�.�C��@C�O@C�f@C�+�C�@C`�@CV5@CV5@CP�@B�@B�`@Bץ@B��B�:�B��@B�h�B�E@BfD@B]	�BQ,@A�@A�b�Aڅ@A�?@A-�A%�A��Ag@A�@�@@��@@qJ@@+j�@�@@�?��?�@?�\@?�s@?��@?O@@?/�@?�>��>���>l~@>H�>5@=2�@<�{�;��@:��@:Q�9�%@7�7�O�7{X@6�F�6@A�5��Evgeniy Patlan <evgeniy.patlan@percona.com>Evgeniy Patlan <evgeniy.patlan@percona.com> Evgeniy Patlan <evgeniy.patlan@percona.com>Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.11-4Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-3Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-2rc2Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-1rc1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.9-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasu�x����������������������X
top?.0al��������ȍ`Epdat�$p����������������
`EaE_E
�ki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Remove "Report bug" button when mozplugger plugin is used (#1290135)
- Change "check_for_man" return value upon failure (#1431191)
- Fix "plugin details" message content
- Add "init_args" function to Plugin
- Fix sealert crash when setroubleshootd fails to start (#1405003)
- Improve obtaining AVC object path
- Fix setroubleshootd.8
- Fix report problem summary string
- sealert - provide a better error message when SELinux is disabled
- Spelling fixes
- Python 3.6 invalid escape sequence deprecation fixes- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuild for Python 3.6- Fix "list all alerts" in sealert gui (#1370272, #1332485)
- Fix sealert message for capability2 (#1360392)- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- setroubleshootd fixed to catch all subprocess exceptions
- Translations updated- Do not use dangerous shell=True
- Use subprocess.check_output() with a sequence of program arguments- fixed get_all_alerts_ignored()- added setroubleshootd_log.log_full=True|False directive
- setroubleshootd_log.level and sealert_log.level can be set to
  different values
- get_alert() and get_all_alerts_since() DBUS APIs change to use
  number of microseconds instead of date string
- setroubleshoot.conf cleanup- Added new methods to DBUS API:
  set_filter(), get_all_alerts_ignored(), delete_alert()- Translations updated (#1322654)
- Suggest my-<command>.pp modules instead of mypol.pp (#1329037)- Drop unwanted debug message in sedispatch (#1326985)- setroubleshoot: Ensure that dbus string param isn't null- get_alert() DBUS API extended with more parameters
- sedispatch uses a timeout when collecting audit events (#1322771)
- Use correct packaging for byte compiled files (#1321047)- fixed traceback in SetroubleshootFixit.py (#1279396)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- fixed few UI browser problems
- extended DBUS API, see DBUS.md
- import MIMEText from the right module (#1297111)
- Fix several GTK deprecated warnings- Rebuilt for https://fedoraproject.org/wiki/Changes/python3.5- Move the AppData file to the right subpackage so it gets used.- Sanitize requires for Python 3- port setroubleshoot to Python 3- setroubleshoot-server depends on policycoreutils-python-utils (#1246625)- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- translations updated from https://fedora.zanata.org/project/view/setroubleshoot
- setroubleshoot_database.xml and email_alert_recipients are %ghost again- setroubleshootd is set to be run as setroubleshoot user instead of root user
- several bugfixes- Add an AppData file for the software center- Ship a symbolic setroubleshoot icon (#1182652)
- Fix get_rpm_nvr_*_temporary functions - CVE-2015-1815 (#1203352)- Provide the policy rpm in Bugzilla bug reports by jfilak@redhat.com- Rebuild for rpm bug 1131960- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Fix handling of target paths that decode screws up- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Remove at_console lines from policykit so cockpit can use dbus interfaces.- Add the policy rpm string to the user comments of an already reported bug from jfilak@redhat.com- Stop sending syslog.LOG_DEBUG Messages unless loglevel is set to debug- Stop sending syslog.LOG_DEBUG Messages unless loglevel is set to debug- Fix unicode settings- Remove requires for notify-python and yum- Don't error out on no policy installed
- Update translations.- Eliminate requirement on service script.- Update Lanquages
- Use setup.py in Makefile for setroubleshoot dir- Add requires for libreport-python- Remove "the the" typo from code.
- Update Translations- Move some of the Requires block down to -server package- Fix typo again in audit_data.py
- Make setroubleshoot less noicy in logs- Fix typo in audit_data.py- fix systemd-python requirement versionin�x�������������p������X
r �?64/l8��������_ for�$����������������
�_�_�_
�efix length to 128
- Add address-prefix-lenght option to change default value
- Fix backporting issues- Resolves: #1685560 - Drop executable flag from NM dispatcher- Resolves: 1647786 - Recalculate renew time if it's greater than expirity time- Related: #1623794 - Drop compat subpackage- Resolves: #1623794 - Mmap() leases in replay mode only- Update to bind 9.11.4- Resolves: #1589966 - Handle dhcp4-change event.- Always send hardware as identifier- Do not use eval in dhclient scripts- Bring dhclient.conf back (#1579768)- Fix for CVE-2018-1111- Don't use run-parts for hooks discovery (#1558612)- Own ldap schema directory (#1553432)- Fix CVE-2018-5732 CVE-2018-5733 (#1550246)- Compile with recent bind includes, that does not include isc/util.h- Do not rely on ignoring case sensitivity of VERSION variable- Use bind-export-libs package instead of bind99
- Use isc-config.sh to configure bind libs
- Change requirement to bind-export-devel- Do not parse sysconfig/network-scripts if initscripts not installed (#1098172)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- Use released version- Change duid_uuid patch to not use std99 feature- Fix omapi SD leak (#1523547)- Add patch for proper signal handling with shared context (#1457871)- Do now override hostname variable in script- Rebuild for bind 9.9.11- Fix typos in dhclient-script- Recreate /etc/resolv.conf if NetworkManager screwed it up (#1475279)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- New version 4.3.6- Rebuild due to bug in RPM (RHBZ #1468476)- Rebuild for bind 9.9.10- Drop chown from the post section- Don't open ddns port until it's needed. Credits to Petr Menšík for the original idea- don't build doxygen documentation during modular build- Add EnvironmentFile parameter for backward compatibility- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- get BUG_REPORT_URL from /etc/os-release (#1399351)- 4.3.5- 4.3.5b1- [dhclient] rename -R option to --request-options (#1357947)
- [dhclient] rename -timeout option to --timeout- Rebuild against bind99-9.9.9-P1- 4.3.4
- disable systemtap (I don't think anybody ever used it)- Mentioning the bash script is needed in README.dhclient.d- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- 4.3.3-P1 - fix for CVE-2015-8605 (#1298077)- Rebuild against bind-9.9.8-P2- implement DUID-UUID (RFC 6355) and make it default DUID type (#560361#60)- dispatcher.d/12-dhcpd: use reset-failed command- dhclient-script: hostname -> hostnamectl --transient- dhclient-script: source ifcfg-* because of PEERDNS (#1277253)- dhclient-script: fix for gateway not in the end of rfc3442 routes list (#1251644)- dhclient-script: make_resolv_conf(): keep old nameservers
  if server sends domain-name/search, but no nameservers (#1269595)- dhclient: make sure link-local address is ready in stateless mode (#1263466)- VLAN ID is only bottom 12-bits of TCI (#1259552)- 4.3.3- dhclient-script: respect DEFROUTE/GATEWAYDEV if Classless Static Routes are offered (#1251644)- 4.3.3b1
- enable krb5/gssapi authentication for OpenLDAP
- enable support for binary insertion of leases- fix ipcalc requires- remove dependency on initscripts (#1098172)
- make path to resolv.conf configurable (#1086425)- spec cleanup- test upstream fix for #866714 (paranoia.patch)- add more randomness into xid generation (#1195693)- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- dhclient-script: run also scripts in dhclient-[enter/exit]-hooks.d dir- dhclient-script: add a minute to address lifetimes (#1188423)- dhclient-script: amend previous change (#1210984)- dhclient-script: fix shellcheck.net suggestions- rebuild against bind99 9.9.7 package- 4.3.2- correctly set IB's hw->hlen (#1185075)- Rebuild against bind-9.10.2rc2- dhclient-script: use 'ip addr replace' for both BOUND & RENEW- doc/dhclient/dhclient-enter-hooks for dhclient-script debugging- dhclient-script: s/addr add/a�x���������������������X
ke�?rd-c��������P�
onfi�$����������������


�'0?IUdms}�����������



)
5
@
J
\
f
n
v
�
�
�
�
�
�
�
�
�
�
�
#0;DN^jr{���

	
	



	











	
	
	RPPPPPPPPPPPP	P	P
RRRRRRRR
RRR1PP
RRRRRRRR
RRR1P
PRRRRRRR1R R$RR#RRRRRRRR
RRR1R RRRRRR
RRR1RR R#RRRRRR
RRR1R"R RR#RRRRRR
RRRRR1R RRRRR
RRR1RRR
RRR1R#RR RRRR
RRR1RR R%R#RRRRRRR
RRR1RRRRR#R RR&RR
RRR1RR RRRRR
RRR1RR R#RRRRRRRRR
RR1R R�x�������������`�������X
�	�?�	�	��������(v
S�m	h	�$C����������������
S�T�R�
�-devel and -tools subpackages
  - fix spelling mistake in description of -test subpackage
  - convert usage of $$RPM_BUILD_ROOT to %{buildroot} throughout, for
stylistic consistency
  - supply dirmode arguments to defattr directives- update python-2.6.2-config.patch to remove downstream customization of build
of pyexpat and elementtree modules
- add patch adapted from upstream (patch 3) to add support for building against
system expat; add --with-system-expat to "configure" invocation
- remove embedded copy of expat from source tree during "prep"- introduce macros for 3 directories, replacing expanded references throughout:
%{pylibdir}, %{dynload_dir}, %{site_packages}
- explicitly list all lib-dynload files, rather than dynamically gathering the
payload into a temporary text file, so that we can be sure what we are
shipping; remove now-redundant testing for presence of certain .so files
- remove embedded copy of zlib from source tree before building- change python-2.6.2-config.patch to remove our downstream change to curses
configuration in Modules/Setup.dist, so that the curses modules are built using
setup.py with the downstream default (linking against libncursesw.so, rather
than libncurses.so), rather than within the Makefile; add a test to %install
to verify the dso files that the curses module is linked against the correct
DSO (bug 539917; changes _cursesmodule.so -> _curses.so)- rebuild (bug 556975)- move lib2to3 from -tools subpackage to main package (bug 556667)- patch Makefile.pre.in to avoid building static library (patch111, bug 556092)
- split up the "configure" invocation flags onto individual lines- replace usage of %define with %global
- use the %{_isa} macro to ensure that the python-devel dependency on python
is for the correct multilib arch (#555943)
- delete bundled copy of libffi to make sure we use the system one
- replace references to /usr with %{_prefix}; replace references to
/usr/include with %{_includedir}- automatically disable arena allocator when run under valgrind (upstream
issue 2422; patch 52)
- add patch from Josh Boyer containing diff against upstream PyBSDDB to make
the bsddb module compile against db-4.8 (patch 53, #544275); bump the necessary
version of db4-devel to 4.8
- patch setup.py so that it searches for db-4.8, and enable debug output for
said search; make Setup.dist use db-4.8 (patch 54)- fixup the build when __python_ver is set (Zach Sadecki; bug 533989); use
pybasever in the files section- "Makefile" and the config-32/64.h file are needed by distutils/sysconfig.py
_init_posix(), so we include them in the core package, along with their parent
directories (bug 531901)- Update to 2.6.4- rebuilt with new openssl- Update to 2.6.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Move python-config to devel subpackage (#506153)
- Update BuildRoot for new standard- Update python-tools description (#448940)- Replace python-hashlib and python-uuid (#484715)- Use system libffi
- Resolves: bug#490573
- Fix SELinux execmem problems
- Resolves: bug#488396- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- rebuild with new openssl- Fix distutils generated rpms.
- Resolves: bug#236535- Enable -lcrypt for cryptmodule- Update to 2.6- Move to 2.5.2
- Fix CVE-2008-2316 hashlib overflow.- Fix up the build for new rpm
- And actually build against db4-4.7 (#455170)- fix license tag
- enable support for db4-4.7- Fix sporadic listdir problem
- Resolves: bug#451494- Rebuild to re-gen autoconf file due to glibc change.
- Resolves: bug#441003- Add more constants to socketmodule- Add constants to socketmodule
- Resolves: bug#436560- Autorebuild for GCC 4.3- rebuild for new tk in rawhide- Add valgrind support files, as doc, to python-devel
- Relates: rhbz#418621
- Add new API from 2.6, set_wakeup_fd ... use at own risk, presumably won't
- change but I have no control to guarantee that.
- Resolves: rhbz#427794
- Add gdbinit support file, as doc, to python-devel- rebuild for new tcl/tk in rawhide- Create a p�x������,x��������X�	?����������������5�$
����������������
555
�8g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g2<g28g28g28g28g28g28g28g28g2<g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g2<g28g28g2<g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g2<g28g28g28g28g28g28g28g28g28g28g28g2<g28g28g28g28g28g28g28g28g2<g28g2<g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g2>g2�g29g29g29713df8936309988acb8db5ebdb0bc8aa33b1fc9cb3843d15b11f7cad74262b151072ecafbe4e531d9d8d0e433a590beebc2f5bedae1ff9d49b7d6c19eb102091b819da0864708f8e2eb3b0d5c3ed6d13764410babba7f86f45459bb37dcb844e13673ab53f108d6b972203fd7449144b4575aca435564f670fd658b9137c82f44bb07fca9580674eb6fb4dae95dff5516a521f330a1f8ff70594e694194bfe796bc12b60d42cdb360a117206d8a5b3f3c55027e59fd933e7ebbb2418b31601b48a823b9d0f877abeba5a3b764929a6ea439c8917dd40f73e3df147e84516e15a091339856d5fbe02618249ee984cb30f49f5c18b12aa78939ac731b0fd87f9b1870ef3fa0af2b3dcf570c4ee61f64c37ce11836a22a34b1a482ab1ef519169b07926937a6f66979d2a0fd834162e40917ce7dcf57ca14f5c289a5b89b0656838713df8936309988acb8db5ebdb0bc8aa33b1fc9cb3843d15b11f7cad74262b15bec42f60afe86f28c866c0590a195c15023403062bf16bc�x�����!������X
z?��������@��4�$/����������������
�4�4�4
�of Module-Build reduced to 0.280801 (CPAN RT#102062)
- Use %license where possible- Perl 5.20 re-rebuild of bootstrapped packages- Perl 5.20 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Update to 0.17022
  - Add "use warnings;" to everything
  - Add a separate LICENSE file- Update to 0.17021
  - Fix for the format of the new Carp in bleadperl (CPAN RT#88137)- Perl 5.18 re-rebuild of bootstrapped packages- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild- Update to 0.17020
  - Change to Shlomi Fish's new E-mail and web address
  - Clarify the licence of lib/Error/Simple.pm (CPAN RT#81277)
  - Correct typos (CPAN RT#85023)
- Don't use macros for commands
- Don't need to remove empty directories from the buildroot
- Make %files list more explicit
- Drop %defattr, redundant since rpm 4.4
- Avoid provides/requires from examples- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Add MIT license- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 re-rebuild of bootstrapped packages- Perl 5.16 rebuild- 0.17018 bump
- Specify all dependencies
- Skip POD tests on bootstrap- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Perl mass rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Rebuild to fix problems with vendorarch/lib (#661697)- Mass rebuild with perl-5.12.0- Mass rebuild with perl-5.12.0- update- rebuild against perl 5.10.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Update to 0.17015.- Update to 0.17014.- rebuild for new perl- Update to 0.17012.- Update to 0.17011.
- Canonicalize Source0 URL.
- Fix find option order.
- Use fixperms macro instead of our own chmod incantation.
- Improve Summary.
- Reformat to match cpanspec output.
- Build with Module::Build.- Upstream update.
- Update license tag.- Update to 0.17008.- Update to 0.17007.- Update to 0.17006.
- New build requirements: Test::Pod and Test::Pod::Coverage.- Update to 0.17005.- Update to 0.17004.- Update to 0.17003.- Update to 0.17001.- Update to 0.17.- Update to 0.16.- Update to 0.15009.- Update to 0.15008.- Rebuild for FC5 (perl 5.8.8).- Dist tag.- rebuilt- Specfile autogenerated.



















	

����0.170250.170251:0.17025-2.el8


perl-ErrorChangeLogREADMEexamplesexample.plnext-in-loopError.pm-eval.plError.pm-next-label.plError.pm-next-out-of-catch.plError.pm-next.plREADMEwarndie.plperl-ErrorLICENSEError.3pm.gzError::Simple.3pm.gzErrorError.pmSimple.pm/usr/share/doc//usr/share/doc/perl-Error//usr/share/doc/perl-Error/examples//usr/share/doc/perl-Error/examples/next-in-loop//usr/share/licenses//usr/share/licenses/perl-Error//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/Error/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnu




directoryASCII textPerl script text executabletroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Perl5 module source textPP
R
PPRRRRRR	P
RRRR	utf-81c99�x�������������Ȓ�������X
�/�?�X_N��������HR������w_UH�r�$g����������������
w_x_v_
�configuration
- as BOUND / RENEW / REBIND / REBOOT if router ping succeeds- fix bug 147926: dhclient-script should do restorecon for modified conf files
- optimize execshield protection- fix bug 147375: dhcpd heap corruption on 32-bit 'subnet' masks
- fix bug 147502: dhclient should honor GATEWAYDEV and GATEWAY settings
- fix bug 146600: dhclient's timeout mode ping should use -I
- fix bug 146524: dhcpd.init should discard dhcpd's initial output message
- fix bug 147739: dhcpd.init configtest should honor -cf in DHCPDARGS- fix bug 145997: allow hex 32-bit integers in user specified options- still need an epoch to get past nvre test- fix bug 144417: much improved dhclient-script- Upgrade to latest release from ISC, which includes most of our
- recent patches anyway.- fix bug 144250: gcc-3.4.3-11 is broken :
- log_error ("Lease with bogus binding state: %d size: %d",
-   comp -> binding_state,
-   sizeof(comp->binding_state));
- prints:    'Lease with bogus binding state: 257 1'    !
- compiling with gcc33 (compat-gcc-8-3.3.4.2 fixes for now).- fix bug 143704: dhclient -r does not work if lease held by
- dhclient run from ifup . dhclient will now look for the pid
- files created by ifup.- NTP: fix bug 139715: merge in new ntp servers only rather than replace
- all the ntp configuration files; restart ntpd if configuration changed.- fix bug 138181 & bug 139468: do not attempt to listen/send on
-     unconfigured  loopback, point-to-point or non-broadcast
-     interfaces (don't generate annoying log messages)
- fix bug 138869: dhclient-script: check if '$new_routers' is
-     empty before doing 'set $new_routers;...;ping ... $1'- dhcp-3.0.2b1 came out today. A diff of the 'ack_lease' function
- Dave Hankins and I patched exposed a missing '!' on an if clause
- that got dropped with the 'new-host' patch. Replacing the '!'.
- Also found one missing host_dereference.- clean-up last patch: new-host.patch adds host_reference(host)
- without host_dereference(host) before returns in ack_lease
- (dhcp-3.0.1-host_dereference.patch)- Fix bug 133522:
- PXE Boot clients with static leases not given 'file' option
- 104 by server - PXE booting was disabled for 'fixed-address'
- clients.- Fix bug 131212:
- If "deny booting" is defined for some group of hosts,
- then after one of those hosts is denied booting, all
- hosts are denied booting, because of a pointer not being
- cleared in the lease record. 
- An upstream patch was obtained which will be in dhcp-3.0.2.- Forward DNS update by client was disabled by a bug that I
- found in code where 'client->sent_options' was being
- freed too early.
- Re-enabled it after contacting upstream maintainer
- who confirmed that this was a bug (bug #130069) -
- submitted patch dhcp-3.0.1.preserve-sent-options.patch.
- Upstream maintainer informs me this patch will be in dhcp-3.0.2 .- Allow 2.0 kernels to obtain default gateway via dhcp- Invoke 'change_resolv_conf' function to change resolv.conf- Upgraded to new ISC 3.0.1 version- Allow dhclient-script to continue without a config file.
- It will use default values.- fix inherit-leases patch- Turn on inherit-leases patch- User kernelversion instead of uname-r
- Update to latest package from ISC
- Remove inherit-leases patch for now.- rebuilt- Update to latest package from ISC- add route back in after route up call- add alex's dhcp-3.0.1rc12-inherit-leases.patch patch- set device on default gateway route- compiling dhcpd PIE- Add static routes patch to dhclient-script- Fix init to check config during restart- Fix init script to create leases file if missing- rebuilt- rebuilt- Fix initialization of memory to prevent compiler error- Close leaseFile before exec, to fix selinux error message- Add BuildRequires groff
- Replace resolv.conf if renew and data changes- Add obsoletes dhcpcd- Fix location of ntp driftfile- Bump Release- Add div0 patch- Add SEARCH to client script- Bump Release- Add configtest- increment for base- Don't update resolv.conf on renewals- increment for base- Fix n�x������1�������X
y?��������p�
LN�$\����������������
LNMNKN
�ad of walking the MRO chain with
   magic exclusions. explicitly connecting is more flexible and
   robust (no getting the wrong object by mistake)
- fix handling of return args in local rpc case
- fix signal connections between audit and logfile
- split databae and database_properties for audit and logfile
- fix initial connection state
- fix lookup_local_id- Speed up startup of service- Many fixes
- Changed the api- Speed enhancments
    [John Dennis <jdennis@redhat.com>]
- log file parsing now approx 4 times faster
- greatly enhance the statistics reporting capability in attempt
   to diagnose slow log file parsing performance
- make gathering of environmenatal information optional,
   environment information is only relevant at the time the
   alert fires, not in a post processing scenario
- clean up several places where environmental information was
   assumed and/or was always gathered, or gathered in the wrong place.- Fix signature for PORT_NUMBER src command- Additional Plugins for port_t and device_t and mislabled files.- Release of first version
- Fix icon
    [John Dennis <jdennis@redhat.com>]
- Memory leak fixes
- Substitution fixes
- File names in hex fixes- Sealert only notify dropped connection once
- setroubleshoot shutdown cleanly
    [John Dennis <jdennis@redhat.com>]
- Gui cleanups- Change close key binding to ctrl-w- Add new plugins cvs_data, rsync_data, xen_image, swapfile, samba_share
    [John Dennis <jdennis@redhat.com>]
- clear the GUI of old data before loading new data,
   fix the code used to display the filter icon in the filter column[John Dennis <jdennis@redhat.com>]
- Major rewrite of the client/server RPC code,- Fix Affected RPMS handling- Fix mail handling
- fix bugs related to recording per user per signature filtering
    [John Dennis <jdennis@redhat.com>]
- fix bugs related to recording per user per signature filtering
    [Karl MacMillan <kmacmill@redhat.com>]
- Add signal handling to client and server.
- Fix minor plugin bugs.[Karl MacMillan <kmacmill@redhat.com>]
- Add rpm information for target.
- Add hostname and uname to signature info
- Add display of the full AVC
- Add display of the analysis id
- Change html generation to be separated out and us elemmenttree
    [John Dennis <jdennis@redhat.com>]
- add CommunicationChannel class to encapsulate data transfer
   operations, in particular to provide an object threads can lock
   during data transfer.
- checkpoint the logfile scanning code, somewhat working- Fix printing- Fix notification window problems.  Now dissappears and does not regenerate if
it has already been seen- Add Icon
    [John Dennis <jdennis@redhat.com>]
- dispatcher.py: rework how audit messages injected into the
   system and processed. Much of this work was in support of log file
   scanning which should be coupled to the exact same processing code
   as audit messages arriving from the audit socket. In essence log
   file scanning synthesizes an audit message and we inject it into
   the system the same way socket messages are injected. This was
   also an excellent moment correctly handle out of order audit
   messages, something we were not able to handle previously. This
   may have been contributing to splitting what should have been a
   single alert into two or more separate alerts because we didn't
   recongize the incoming audit events as a single event. Correctly
   assembling out of order messages introduced a fair amount of extra
   complexity as we now maintain a cache of recent audit events, this
   is fully documented in dispatcher.py
- Turn notifications back on by default.
    [Karl MacMillan <kmacmill@redhat.com>]
- Separated out HTML rendering and made it easier to translate.[Dan  Walsh]
- Hook up the rest of the menu bars on browser window
- Add public_content.py plugin
    [John Dennis <jdennis@redhat.com>]
- add delete_signatures() method to AlertClient class
- start using the AppBar in the browser.
- "open logfile" now connected all the way from browser menu
   to server rpc, still needs impleme�x��������������q�������X

ar�? ble���������L	�47)-�$|����������������
�4�4�4
� "$MYCNF_PACKAGE" == "Percona-Server-server-57" ]; then
      real_file=$(readlink -f /etc/my.cnf)
      if [ -L /etc/my.cnf ] && [ "x${real_file}" == "x/etc/percona-server.cnf" ]; then
          rm -rf /etc/my.cnf
          update-alternatives --install /etc/my.cnf my.cnf "/etc/percona-server.cnf" 200
      else
          echo " -------------"
          echo "   *  The suggested mysql options and settings are in /etc/percona-server.conf.d/mysqld.cnf"
          echo "   *  If you want to use mysqld.cnf as default configuration file please make backup of /etc/my.cnf"
          echo "   *  Once it is done please execute the following commands:"
          echo " rm -rf /etc/my.cnf"
          echo " update-alternatives --install /etc/my.cnf my.cnf \"/etc/percona-server.cnf\" 200"
          echo " -------------"
      fi
  else
      echo " -------------"
      echo "   *  The suggested mysql options and settings are in /etc/percona-server.conf.d/mysqld.cnf"
      echo "   *  If you want to use mysqld.cnf as default configuration file please make backup of /etc/my.cnf"
      echo "   *  Once it is done please execute the following commands:"
      echo " rm -rf /etc/my.cnf"
      echo " update-alternatives --install /etc/my.cnf my.cnf \"/etc/percona-server.cnf\" 200"
      echo " -------------"
      cnflog=$(/usr/bin/my_print_defaults mysqld|grep -c log-error)
      if [ $cnflog = 0 -a -f /etc/my.cnf -a ! -L /etc/my.cnf ]; then
          sed -i "/^\[mysqld\]$/a log-error=/var/log/mysqld.log" /etc/my.cnf
      fi
      cnfpid=$(/usr/bin/my_print_defaults mysqld|grep -c pid-file)
      if [ $cnfpid = 0 -a -f /etc/my.cnf -a ! -L /etc/my.cnf ]; then
          sed -i "/^\[mysqld\]$/a pid-file=/var/run/mysqld/mysqld.pid" /etc/my.cnf
      fi
  fi
fi
echo "Percona Server is distributed with several useful UDF (User Defined Function) from Percona Toolkit."
echo "Run the following commands to create these functions:"
echo "mysql -e \"CREATE FUNCTION fnv1a_64 RETURNS INTEGER SONAME 'libfnv1a_udf.so'\""
echo "mysql -e \"CREATE FUNCTION fnv_64 RETURNS INTEGER SONAME 'libfnv_udf.so'\""
echo "mysql -e \"CREATE FUNCTION murmur_hash RETURNS INTEGER SONAME 'libmurmur_udf.so'\""
echo "See http://www.percona.com/doc/percona-server/5.7/management/udf_percona_toolkit.html for more details"  
if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable --now mysqld.service &>/dev/null || : 
fi 

if [ "$1" = 0 ]; then
  timestamp=$(date '+%Y%m%d-%H%M')
  if [ -L /usr/share/mysql ]; then
      rm /usr/share/mysql
  fi
  if [ ! -L /etc/my.cnf ]; then
    cp -p /etc/my.cnf /etc/my.cnf_backup-${timestamp}
  else
    realfile=$(readlink -f /etc/my.cnf)
    cp "${realfile}" "${realfile}_backup-${timestamp}"
  fi
  cp -rp /etc/percona-server.conf.d /etc/percona-server.conf.d_backup-${timestamp}
  cp -rp /etc/my.cnf.d /etc/my.cnf.d_backup-${timestamp}
fi  
if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart mysqld.service &>/dev/null || : 
fiL
bj
�9I�7
�<4�>
�;�p<��O��7-�9�X7�@6O�D���96���26��7-p7
X1928..'16?559:3;2!=9/95!4*/#&33870. 9E'0%:>7257!2:4,8;K9-4657 ,40?124347=185"8$;;2�{Z@
�1S S��8�^
Z�
3h1 Q�Q���P$`xh9�X)Tو"`�H�H��"p��`-�1h`;bi 84PB�XUh�
.��2��x�
��
��R���� �}8�x�������������0a�������X
.1�?Remi�(��������
�9po.n�$@����������������
�9�9�9
�5d90f8b0a75fa66b9e42d4af4c980bf5ddc633f0124db3cee75714d6bfc2a2d05588ecd7c989397641a03509cd4fa1641ae4e5f3c6674dc831b9b6e7c5f893f560970ac93a92f062b50eae86ff010064084b9b547eb68057169c8092817720899756968fd8123b08e6902a8e5a860b8596c4ecc14b3fb5e505d5417139bee86b44f4a35e6ad854510a370364afc2d5403d21fbf0c51a8327126fb18f657f0e5a18e829da0949291d44ac1237b5fffeb04270f50abb31974879a2d5ea2a3d356a43306f68696678470355eaeb0860e5321f8cdb0c40c4f5f7926ffe852c5d59336f7fc721e0915faee413db963fa83398e345d6274b55acbe2c80f9c24bcb0ab4a62908872a76f9e76a791e9001b154dc476736b125fb5c48d69fd2d80f144249446cf9879d280a10494d2f59d35d965ac9fa21dc13419277e1cbd0bbf04c362312d3f1496bb522183f44ba0a3bf3905e5180722e89449e7192a395c3bacd808d1c23a2b58ebe37645a25c4ec63e332239864c01038112788722ee2464fbcff8ba6ac0b02c00ecfeac84185dd859414a923978d1a7d0c750f2d27af8b770e692369a9cc6928c0b470ccabbca5b0a7f5169012090ab445bef6aada2c7e65e26b6a480df5da4a8d80846cec1e24cc03693a1dce33dc9fa59dc281f0fe8d1d900340aff3067270a42160ee0c211247550a3bab3d8d74cf38acd5101c1eefd4bb0348ddd2277aa8cdfe7025b96de6b26913777ad27997d28db3d24ed72b0f4cbe4eda52890c37774708cd111d388d7897d52ea4508e29ede4d190c97fc5fed78e51248d4b417b48a401eb6231814d45a24aa179e372837ad9946a6632d6b618427e889fcf4931137e99553071e9ea276227b2ae182f7c01331bf17b78c08607caf9f95c72743a56d5b40d0c1eb2197837f3ca0423b827943aeb1123cd36ab2ce2790802db1eab5aa776cee50f0c9a12ca35352ff7f6740e85ca381b49ef65b778091f92e0de508c5b0299f9259c4fcaac0c1e58ea5bfed2b721bd123beac3c1182b16ff3b42cbeee82621d738fd2c58bc474ec72c55fd61cc3675b0d8937d14f83748a1e62d9c08d6e37c1534fd619e57db550aba811ced700bdbe02c3227c41e329fdfd590b390d77c84937219d4ecd19b58a21ba5c83919564530c0cbec5517a5f2af2442885de8ea0814158eb041513db0a118406450bc079159a17b98918c1bcd3b40a3cb7f060679218332b568fe56bfd790fa4d8532a10040../../../../usr/bin/vltest../../../../usr/bin/vltsv../../../../usr/bin/dptsv../../../../usr/bin/odmgr../../../../usr/bin/dptest../../../../usr/bin/qmttest../../../../usr/bin/crmgr../../../../usr/bin/rltest../../../../usr/bin/crtsv../../../../usr/bin/hvtest../../../../usr/bin/odidx../../../../usr/bin/crtest../../../../usr/bin/rlmgr../../../../usr/bin/vlmgr../../../../usr/lib64/libqdbm.so.14.14.0../../../../usr/bin/odtest../../../../usr/bin/cbtest../../../../usr/bin/hvmgr../../../../usr/bin/dpmgr../../../../usr/bin/cbcodeclibqdbm.so.14.14.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootqdbm-1.8.78-42.el8.remi.src.rpm���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������HP�������X�	?��������c������&5�����$6����������������
&5%5'5
�b51ff4da20fdcb9941bd1023aba429915f6563e5af51e02413cf9f6bceda6fdb23d6531d0ff2d4a4d74e6e17f51bfb7d0dd875365f6bfb30a0d2763a5e4254515b74a42e46adfa923f6f9d2c6268653ab683a7422a4c90c716b69f92108979490a86041ceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f1508cca9e20c6af1fcfbf69408f377769286cbeebcded336100c9b4a3f35fbe635e462679b757c0f42517df1da7d57e0b2e01944f8cf9f14cf89f5c3d556f952522f369b9d463b86950f7d166f1504e8b7edad2bc1e2ac6d41c5278b43b361cb7b92cfd8f4c406bf26650a3299b3ef62b464600b48cfe7fb04159866e5797c76547837c1db605493df2acd418781db05d60443d4845b04b4a3513da0851893f2ab271f148121b804b2d30f7b87856b0840eba32af90607328a5756802771f8dbff57e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855c8b3aab046543da33754d28e33142b68b8020b217cab7935d0a6380b51e2fcba945f982cee217509a85ae87879665df182f553de5149d9bbeac34b0576b4be31daf7efde0fdbf01bd9e43a3d6e92c405dbbd75011cbe8310d5f957a4a60524351964a8194a5169b4dff1b93716c3533eb73916cafc60ebf6757e79898d96ede6ec5e2f8f6dc0d8e8210c35a7f605f657efd37973336b56b99c87a3985184509305faba2ab1e27192aba5b92d92b79e47121a5b0068cd43fdf49432d83f3e75d6d155b34fb53fc727a74cfc0455abf1aaf75e7bddc63ef0051e747752ef7569175efa7e22b172449f514e122b3f17c4a5508319f96324f5914d98b2a2993bd2126f790f8599f6c360fdc1e9e096d5f99c621943711150e43953e2b9bc728f75e8191efa92ea50ce7d71f6c283697b84e81e85b19e0e91f46d1bba677655cfbd0e9a73599090a2f431cb23fab8953b9da03d265bdee1fc0a005a5ee9acd3cb5c97e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855c79f44850e7b4cc4fe9134722d9576e4766f6061b06ee713a3a88a87f3b4b4cc9e80ef03efaf54a54a960e3d5ccb99e7f1298bce635bb80c38a7e21ae276b2a53721fc55c14bbeeee35301faaf82a82ff538e4e28556953227967b811008fcb7ceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f15088d3928f9dc4490fd635707cb88eb26bd764102a7282954307d3e5167a577e8a49f1c46e73683d9ea082946b4e5b6d85ed256bf1cc45ec8cdd1e2574f1839c816b2b1e6322e007a05e20efa7529591dd5bafb9a1c3bea0071c0d77c5f2a21cc91e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b85561501709a7105e7ce743efe5323f0dbeaaeced83ed30fd691d10b0f447325914ae98f42153138ac02387fd6f1b709c7fdbf98e9090c00cfa703d48554e597614cad2a7a72e7f157bcb70949e3df5071ca0af23fbde3db12974c1b11b7def3f3ed3801eff9a2cc5a8692476b75c165401fe308ba5d7df6811f03e97ea9eb81840ceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f150804b80f5b077bbed68808cfebadeb5e3523f2a8c9a96495c587bd96df1eac2a33c41482302812fdc6969d6b2cc396c8cc9ee2830036ebb7ef0a23b55ba8a8b580fddc8f6fba0291c369b5d1022aca7e8adbaa3e6d6f7c16dd56d9fce4211c7fdc48a118e140d2b67795a4e38ea77984f34bd7a588413c84f14ccd976398e3212043d7f90bd2298d8c68d1dd8f2bd794727920c4773da475b08c431a00d3ca3422ac4ed6477ad97cd2b1588f7e8e7ea1b0708097b303901f859ae41bc568c57a14eb107fb5a7c6be184ce57be3d0ebdade83c2d921215652d310e6d52e76b37a23cd05edeee47f9bc8145be7c8da1260d0aa129091705eff111949040d9d7bedd4b4a9c0d6b752a0f1e9db71670cbd660c6c05a3e523e9f5df03abc0ea47281147f6d9e3178e104686d1f33d051aa02601963ec0c48139a7b54943ea1dc728c2a7cb125a94878f6ebd66cff5b1007a244b0c8fe4255875ee389be9e89479db24da879648ccb73a0455579c6c9cf713ea656512eea1b2ef21520ea5deebc49af33ebfd45d0ffa2f03cac2b6ab02f7922f922e55ebaeeb00e84682cddf6f6abdc693412e2ec420c8ec986d4f28e1d61967080fa0ca799ab335b125a4512c69096b50aceff5a442d1c35808d431359b8822da293924c7e9c68b800022d7a513e55440bfac53892e14d24bc3732e21fc10d1a39bf7f5942e8fe20c4582efe444dd759b1cc5ea47c92cdb0b5db0dc46696a50fcfcaa22fb62ba8b3fbdfd6a282cbe730897d4d37703083298ba8c39091a742013d72f4c847b0809ed209afc1061edde96fc61ff505d519fdbc2e00be68099baaa3ed15175c6ddea8a3dcf1b3f1c7204a139dc107f033d92dababe5081e377b11509b10c1b63d8c04d74af0b625d79b63c2cfd70eef996be62b0caa2da535676e3714e58635032b80c519aef805b8e95ca6205584e1d82ad72286e8faf324eff2bd9b001775dfcba81e3e21b600050e3cf454475ecde5ff20a624010655cbdf83fd16d3aed6684721a01fdd62658394b8262094df184be51a1c4bf6936731828b4d584f3b7475f6d3eebc1322a888a5180e5d5fbb350d4ea94c138c23aa13567ffc0679abbbf963f77d81e9be2fdbd1e58112c2e5d65ed5eb2846a�x������������� @�������X

cg�? add��������`{������Q�i) f�$A����������������
Q�R�P�
�ad from.- So, 5 or 6 people have said it works for them with this patch...- Fixed bug #169159 (check for argc>0 and argv[0] == NULL, not just
    argv[0][0]='\0')
  Reworked the patch from -8 a bit more.- Fixed bug #169159 (don't let python core dump if no arguments are passed in)
  Reworked the patch from -8 a bit more.- Fix bug #169046 more correctly.- Fixed bug #169046 (realpath is unsafe); thanks to
  Peter Jones <pjones@redhat.com> and Arjan van de Ven <arjanv@redhat.com> for
  diagnosing and the patch.- Fixed bug #168655 (fixes for building as python24)- Fixed bug #163435 (pynche doesn't start))- Fixed bug #143667 (python should own /usr/lib/python* on 64-bit systems, for
  noarch packages)
- Fixed bug #143419 (BuildRequires db4 is not versioned)- updated to 2.4.1- building the docs from a different source rpm, to decouple bootstrapping
  python from having tetex installed- Rebuild to pick up new libssl.so.5- Fixed security issue in SimpleXMLRPCServer.py (#146647)- Rebuilt for new readline.- db-4.3.21 returns DB_BUFFER_SMALL rather than ENOMEM (#141994).
- add Provide: python(abi) = 2.4
- include msgfmt/pygettext *.pyc and *.pyo from brp-python-bytecompile.- Python-2.4.tar.bz2 (final)- Python-2.4c1.tar.bz2 (release candidate 1)- rebuild against db-4.3.21.- fix the lib64 patch so that 64bit arches still look in /usr/lib/python...- cryptmodule still needs -lcrypt (again)- Updated to python 2.4b2 (and labeled it 2.4-0.b2.1 to avoid breaking rpm's
  version comparison)- Fixed bug #138112 (python overflows stack buffer) - SF bug 105470- Fixed bugs #131439 #136023 #137863 (.pyc/.pyo files had the buildroot added)- Fixed bug #136654 (python has sketchy audio clip)- Fixed bug #77418 (Demo dir not packaged)
- More tweaking on #19347 (Moved Tools/ under /usr/lib/python2.3/Tools)- Fixed bug #129769: Makefile in new python conflicts with older version found
  in old python-devel
- Reorganized the spec file to get rid of the aspython2 define; __python_ver
  is more powerful.- Including html documentation for non-i386 arches
- Fixed #125362 (python-doc html files have japanese character encoding)
- Fixed #128923 (missing dependency between python and python-devel)- Fixed #128030 (help() not printing anything)
- Fixed #125472 (distutils.sysconfig.get_python_lib() not returning the right
  path on 64-bit systems)
- Fixed #127357 (building python as a shared library)
- Fixed  #19347 (including the contents of Tools/scripts/ in python-tools)- rebuilt- Added an optik.py that provides the same interface from optparse for
  backward compatibility; obsoleting python-optik- Patched bdist_rpm to allow for builds of multiple binary rpms (bug #123598)- Updated to 2.3.4-1 with Robert Scheck's help (bug #124764)
- Added BuildRequires: tix-devel (bug #124918)- Correct fix for #122304 from upstream:
  http://sourceforge.net/tracker/?func=detail&atid=105470&aid=931848&group_id=5470- Fix for bug #122304 : splitting the domain name fails on 64-bit arches
- Fix for bug #120879 : including Makefile into the main package

- Requires XFree86-devel instead of -libs (see bug #118442)- Requires XFree86-devel instead of -libs (see bug #118442)- rebuilt- rebuilt- upgrade to 2.3.3.- rebuild against db-4.2.52.- more rebuilding for new tcl/tk- rebuild against db-4.2.42.- rebuilt against newer tcl/tk- added a Provides: python-abi- force CC (#109268)- cryptmodule still needs -lcrypt- Added patch for missing mkhowto- Updated to 2.3.2- 2.3.1 final- Building the python 2.3.1 release candidate
- Updated the lib64 patch- Building python 2.3
- Added more BuildRequires
- Updated the startup files for modulator and pynche; idle installs its own
  now.- Rebuilt against newer db4 packages (bug #98539)- rebuilt- Rebuilt- Upgraded to 2.2.3- Rebuilt- Modified the ftpuri patch conforming to http://ietf.org/rfc/rfc1738.txt- rebuilt- Fixed bug #84886: pydoc dies when run w/o arguments
- Fixed bug #84205: add python shm module back (used to be shipped with 1.5.2)
- Fixed bug #84966: path in byte-�x��������������/�������X
$?����������2�
�$%����������������
��
�584b16d97fb?���u�%�M?��	��矩TW��3
!��y덏%���!�E�/�֡i^^w
	!�E�/�֡��~kĵ���e�¼5�	3���&��4�W�Z)��M���#�ڐ�{<x�+?����6Ʈ��R�.��cp2<հK���@�5�/ɫ��R�m�G{�2H�?K��{.��p�b�>i��*�
r�
��{�t藈��s|�P�N+�$�"����g#$��cum�
�,
��n��8���K���u���3�y�R�fp����KJ��˸#��$	�,�?@����W%-��i;�Oi��ps\���;&cqHuRT��_�2?}]I=�Ż�d��#������S���tc��Rb�9[*�̌���j��%(l���O?V�2w�V$®�2�/�.��۝V��w�޶.C5L�%��B�߲c�}HG�$�`VL�:�������q�7f��C�e+89F�˄7&�@�>�L���'s�{m_'7�On{7o
��VB�<��&�X�59��=���x
�T���+D7���}��ׄ�ݭ�Y�AL�����X+�@��`�Rr����F!<�'�T64bb2b9bf5433921dd1518079d62251070b5f4c062157d6ec98147e7262c1e1f148fcfc9f174c80bc2705d851915d09d2fbe2dd0ij�c�pij�coject.org/wiki/Fedora_19_Mass_Rebuild- Update to libpng 1.5.13 for minor bug fixes- Update to libpng 1.5.12 for minor bug fixes
- Activate chunk size limits by default, with a very generous default limit- Remove compat subpackage (it's now a separate package "libpng12")
- Minor specfile cleanup per suggestions from Tom Callaway
Related: #845110- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Update to libpng 1.5.10 and 1.2.49, for minor security issues (CVE-2011-3048)
Resolves: #809597- Update to libpng 1.5.9 and 1.2.48, for minor security issues (CVE-2011-3045)
Resolves: #801667- Fix CVE-2011-3026
Resolves: #791183- Update to libpng 1.5.8, for minor security issue (CVE-2011-3464)- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Update to libpng 1.5.7, for assorted minor fixes- Don't include libpng12.pc in the compat subpackage; instead just offer a
  phony Provides: for it in the devel subpackage- Update to new major release series 1.5.x; includes source-code-incompatible
  API changes and a soname version bump
- Temporarily package 1.2.46 shared library (only) in libpng-compat subpackage
  so that dependent packages won't be broken while rebuilding proceeds- Update to libpng 1.2.46, includes fixes for CVE-2011-2501, CVE-2011-2690,
  CVE-2011-2691, CVE-2011-2692
Resolves: #717509
Resolves: #721307- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Use xz compressed source tarball
Resolves: #647282- Update to libpng 1.2.44, includes fixes for CVE-2010-1205 and CVE-2010-2249
Resolves: #609161- Update to libpng 1.2.43, includes fix for CVE-2010-0205
Related: #566234- Update to libpng 1.2.42- Update to libpng 1.2.39- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Update to libpng 1.2.37, to fix CVE-2009-2042
Related: #504782- Update to libpng 1.2.35, to fix CVE-2009-0040- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Update to libpng 1.2.34- rebuild to get provides pkgconfig(libpng)- Update to libpng 1.2.33- Apply upstream patch for zTXT buffer overrun (CVE-2008-3964)
Related: #461599- Update to libpng 1.2.31- Update to libpng 1.2.29 (fixes low-priority security issue CVE-2008-1382)
Related: #441839- Update to libpng 1.2.24- Update to libpng 1.2.22, primarily to fix CVE-2007-5269
Related: #324771- Update License tag
- Rebuild to fix Fedora toolchain issues- Add patch to fix CVE-2007-2445
Related: #239542- Update to libpng 1.2.16
Resolves: #211705, #216706, #227334
- Separate libpng.a into a -static subpackage
- Other minor packaging fixes per Fedora merge review
Resolves: #226038- Require pkgconfig in the -devel subpackage as it gets called by
  /usr/bin/libpng-config- Disable asm on arches other than i386  (#196580)- rebuild- Fix some paths in the -config script- fix multilib conflicts- Add a comment about the need to keep static libraries- Re-add static libraries- Update to 1.2.10
- Drop static libraries- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Rebuild with gcc4- Update to 1.2.8- Update to 1.2.7- Update to 1.2.6
- Combine patches- Build for FC3- Include LICENSE.- Build for FC2- Replace the patches for individual security problems with the
  cumulative pa�x��������������������X
b9y?2fd7����������4ead1�$.����������������
�4�4�4
�tka Plesnikova <jplesnik@redhat.com> - 1:0.17024-10Jitka Plesnikova <jplesnik@redhat.com> - 1:0.17024-9Fedora Release Engineering <releng@fedoraproject.org> - 1:0.17024-8Jitka Plesnikova <jplesnik@redhat.com> - 1:0.17024-7Jitka Plesnikova <jplesnik@redhat.com> - 1:0.17024-6Fedora Release Engineering <releng@fedoraproject.org> - 1:0.17024-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17024-4Jitka Plesnikova <jplesnik@redhat.com> - 1:0.17024-3Jitka Plesnikova <jplesnik@redhat.com> - 1:0.17024-2Paul Howarth <paul@city-fan.org> - 1:0.17024-1Paul Howarth <paul@city-fan.org> - 1:0.17023-1Jitka Plesnikova <jplesnik@redhat.com> - 1:0.17022-4Jitka Plesnikova <jplesnik@redhat.com> - 1:0.17022-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17022-2Paul Howarth <paul@city-fan.org> - 1:0.17022-1Paul Howarth <paul@city-fan.org> - 1:0.17021-1Jitka Plesnikova <jplesnik@redhat.com> - 1:0.17020-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17020-3Petr Pisar <ppisar@redhat.com> - 1:0.17020-2Paul Howarth <paul@city-fan.org> - 1:0.17020-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17018-6Marcela Mašláňová <mmaslano@redhat.com> - 1:0.17018-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17018-4Petr Pisar <ppisar@redhat.com> - 1:0.17018-3Petr Pisar <ppisar@redhat.com> - 1:0.17018-2Petr Pisar <ppisar@redhat.com> - 1:0.17018-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17016-7Marcela Mašláňová <mmaslano@redhat.com> - 1:0.17016-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17016-5Marcela Maslanova <mmaslano@redhat.com> - 1:0.17016-4Marcela Maslanova <mmaslano@redhat.com> - 1:0.17016-3Marcela Maslanova <mmaslano@redhat.com> - 1:0.17016-2Marcela Mašláňová <mmaslano@redhat.com> - 1:0.1716-1Stepan Kasal <skasal@redhat.com> - 1:0.17015-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17015-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:0.17015-2Steven Pritchard <steve@kspei.com> 1:0.17015-1Steven Pritchard <steve@kspei.com> 1:0.17014-1Tom "spot" Callaway <tcallawa@redhat.com> 1:0.17012-2Steven Pritchard <steve@kspei.com> 1:0.17012-1Steven Pritchard <steve@kspei.com> 1:0.17011-1Ralf Corsépius <rc040203@freenet.de> - 1:0.17010-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.17008-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.17007-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.17006-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.17005-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.17004-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.17003-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.17001-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.17-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 1:0.16-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 0.15009-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 0.15008-1Jose Pedro Oliveira <jpo at di.uminho.pt> - 0.15-4Jose Pedro Oliveira <jpo at di.uminho.pt> - 0.15-3Michael Schwendt <mschwendt[AT]users.sf.net> - 0.15-2Steven Pritchard <steve@kspei.com> 0:0.15-1- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Update to 0.17025
  - Fix 'use Error::Simple' overriding the $VERSION (CPAN RT#122713)
- Drop EL-5 support
  - Drop BuildRoot: and Group: tags
  - Drop explicit buildroot cleaning in %install section
  - Drop explicit %clean section- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Perl 5.26 re-rebuild of bootstrapped packages- Perl 5.26 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Perl 5.24 re-rebuild of bootstrapped packages- Perl 5.24 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Perl 5.22 re-rebuild of bootstrapped packages- Perl 5.22 rebuild- Update to 0.17024
  - Add link to the VCS repository in META.yml- Update to 0.17023
  - Minimal version �x���������������������X
Ad�	?nabl��������������05l en�$ ����������������
05/515
�provisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioning_sysadm�x���������������������X
on;?hat.��������HR�������	ton �$I����������������
�	�	�	
�27606f116ecbf17fc066039997d705aad55c72dd25887194c73afdf0fa72ea1ca4753ecf7015fbbff09172a667168accc0bd65ef8629935b4f19efefcdca745ddf260a635a3f91cb397a57123be54fd9302279aa161cd56fe205168ef5dfa3d402995ea12d277efc7d86116af760c0cc34177b374be9b4f4fc5785fa281d651a7336210d79e3c188ca49240167889944e54afc36f438310153b2b8b35ff94747c4059a6bba62997682357ccdc2cfc4aba8856ac5ac13a2260e45672e0a627233f32b038e30316dbdc1daa5ab5f27db218d551819ade437fc3576997ff5e9a65b6f67896cb95019d867086bee6865cf83eb4eb26895ec726ea4eddc8ebf805dff74637ea2722cba1288b70d409252af210e3acf2c95a17ea5f591bc56f96a05572fe6b21b5abda655288a8051e29ac1111e4217a072aee7f0b6672e44a7acd9a86b46c37fd42766c8879525f4c36938c189bc3259ed00c5d1b18eeda71da3a804ea823b03223ac18e53a3cd14fd1d564f551dd3d478be21f682931f4971efd397a0a74ddd1fe9858d9b804527fc56835a2a29bffbc2008a105d7e9782b796be41179bc07617d93160abb7a482294269abe8a15fb5c3c91db6b5dd24ae931b91a3d2cb5a54f38db8ea520a914ecee173de76e3ad52d0484b4d2c27528b9a23b13365e4121f7ed0de0d86763afea5fcf5c4e39b75bbfde8a00a5fcbc8ef4d6097373928163e0881c57fc1e9279a03dc2d8ac1305b3f9ef544090f8006067ec6ea9ae6537d8ba08cd01463dd891e1bce2369edbd6e5d60fb6882aabba87f2a70b98e9699b1a1f5c0963f1445ad4f19588a8964b5891c7c66750af9cec826d6b45b78037e804f55348ba0ad064899fe18e41b5176f77c0b4ed914b4df792fe5be3fc9python2.7site-packageslibpython2.7.so.1.0python2.7BaseHTTPServer.pyBaseHTTPServer.pycBaseHTTPServer.pyoBastion.pyBastion.pycBastion.pyoCGIHTTPServer.pyCGIHTTPServer.pycCGIHTTPServer.pyoConfigParser.pyConfigParser.pycConfigParser.pyoCookie.pyCookie.pycCookie.pyoDocXMLRPCServer.pyDocXMLRPCServer.pycDocXMLRPCServer.pyoHTMLParser.pyHTMLParser.pycHTMLParser.pyoMimeWriter.pyMimeWriter.pycMimeWriter.pyoQueue.pyQueue.pycQueue.pyoSimpleHTTPServer.pySimpleHTTPServer.pycSimpleHTTPServer.pyoSimpleXMLRPCServer.pySimpleXMLRPCServer.pycSimpleXMLRPCServer.pyoSocketServer.pySocketServer.pycSocketServer.pyoStringIO.pyStringIO.pycStringIO.pyoUserDict.pyUserDict.pycUserDict.pyoUserList.pyUserList.pycUserList.pyoUserString.pyUserString.pycUserString.pyo_LWPCookieJar.py_LWPCookieJar.pyc_LWPCookieJar.pyo_MozillaCookieJar.py_MozillaCookieJar.pyc_MozillaCookieJar.pyo__future__.py__future__.pyc__future__.pyo__phello__.foo.py__phello__.foo.pyc__phello__.foo.pyo_abcoll.py_abcoll.pyc_abcoll.pyo_osx_support.py_osx_support.pyc_osx_support.pyo_pyio.py_pyio.pyc_pyio.pyo_strptime.py_strptime.pyc_strptime.pyo_sysconfigdata.py_sysconfigdata.pyc_sysconfigdata.pyo_threading_local.py_threading_local.pyc_threading_local.pyo_weakrefset.py_weakrefset.pyc_weakrefset.pyoabc.pyabc.pycabc.pyoaifc.pyaifc.pycaifc.pyoantigravity.pyantigravity.pycantigravity.pyoanydbm.pyanydbm.pycanydbm.pyoargparse.pyargparse.pycargparse.pyoast.pyast.pycast.pyoasynchat.pyasynchat.pycasynchat.pyoasyncore.pyasyncore.pycasyncore.pyoatexit.pyatexit.pycatexit.pyoaudiodev.pyaudiodev.pycaudiodev.pyobase64.pybase64.pycbase64.pyobdb.pybdb.pycbdb.pyobinhex.pybinhex.pycbinhex.pyobisect.pybisect.pycbisect.pyobsddb__init__.py__init__.pyc__init__.pyodb.pydb.pycdb.pyodbobj.pydbobj.pycdbobj.pyodbrecio.pydbrecio.pycdbrecio.pyodbshelve.pydbshelve.pycdbshelve.pyodbtables.pydbtables.pycdbtables.pyodbutils.pydbutils.pycdbutils.pyocProfile.pycProfile.pyccProfile.pyocalendar.pycalendar.pyccalendar.pyocgi.pycgi.pyccgi.pyocgitb.pycgitb.pyccgitb.pyochunk.pychunk.pycchunk.pyocmd.pycmd.pyccmd.pyocode.pycode.pyccode.pyocodecs.pycodecs.pyccodecs.pyocodeop.pycodeop.pyccodeop.pyocollections.pycollections.pyccollections.pyocolorsys.pycolorsys.pyccolorsys.pyocommands.pycommands.pyccommands.pyocompileall.pycompileall.pyccompileall.pyocompiler__init__.py__init__.pyc__init__.pyoast.pyast.pycast.pyoconsts.pyconsts.pycconsts.pyofuture.pyfuture.pycfuture.pyomisc.pymisc.pycmisc.pyopyassem.pypyassem.pycpyassem.pyopycodegen.pypycodegen.pycpycodegen.pyosymbols.pysymbols.pycsymbol�x�������������x������X
ul�	?FLAG����������<5to f�$,����������������
<5;5=5
�9.8.dist-info//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/psycopg2//opt/lc/lwdbadmin/virtualenv/lib64/python3.6/site-packages/yaml//usr/share/doc//usr/share/doc/lwdbadmin-python3//var/lib//var/log//var/log/lwdbadmin/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x���������������������X
0d�?cbd8������(��������h1de4�$z����������������
�h�h
�
�����������������������
























































































































































































































































RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRP
PRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRhttps://bugs.rockylinux.orgutf-8b41640564b88997358bd2c31f42727592503b1a016df38a5bc38ecd72490a288?���	�L'��V��Y��i* ��3
!pQ�p�)�Tξ7��]�mtZ`hv	j
	�]�mtZ`����s������̣KS��l�y|5O���=�Z�F��
2���C^�l���|�`E�y�����T�9��/��G��C���Y;�F�x�3
�ʾ}Z�ߛ,}y��J��xK���H,D6E�򌆪�9�JO�z$��Xڽ��^ÂXU �
��0���d��PH�I�ũ���ץ��mnB�}J＇'�A���G�Cॗ�k^��S��G�+���+�}�V|���F�#�%Kn��m�����͐�l��O��b�\�h5��c�
���j
ٷۋ9�#�$�Z��Jv`�G�t)O�W����~h%J��|�tQ���+��1�-ӈz�gR9��[��͛!��W'��CB�W+�s
�Z�5Fl�&ޏx[��B�(W;�)��k�8�V��Fhw���o"u�J��DP��j�D�h�T��-.�ױ�C�֞�>X;�uU�C,��s:jCȶ�"_=��=Y�#_��������+w{x�?��� ��,59edfd354197a7f394802a2f6466cd024ff8dc4a7a83ab6ef10947a14cfa30499d638af8d9312f9ac2475f3f71fa8c466e9bc098h�T,-�8h�Tthe static fb_ops directly (Lyude Paul) [1814893]
- [video] video: fbdev: mb862xx: modify the static fb_ops directly (Lyude Paul) [1814893]
- [video] video: fbdev: atyfb: modify the static fb_ops directly (Lyude Paul) [1814893]
- [video] video: fbmem: use const pointer for fb_ops (Lyude Paul) [1814893]
- [video] video: fbdev: vesafb: modify the static fb_ops directly (Lyude Paul) [1814893]
- [video] video: udlfb: don't restore fb_mmap after deferred IO cleanup (Lyude Paul) [1814893]
- [video] video: smscufx: don't restore fb_mmap after deferred IO cleanup �x�������������h�������X
R?��������wa��$q����������������
a�`�b�
� <remi@fedoraproject.org> 7.1.1-2Remi Collet <remi@fedoraproject.org> 7.1.1-1Remi Collet <remi@fedoraproject.org> 7.1.1-0.1.RC1Remi Collet <remi@fedoraproject.org> 7.1.0-2Remi Collet <remi@fedoraproject.org> 7.1.0-1Remi Collet <remi@fedoraproject.org> 7.1.0-0.13.RC6Remi Collet <remi@fedoraproject.org> 7.1.0-0.12.RC5Remi Collet <remi@fedoraproject.org> 7.1.0-0.11.RC4Remi Collet <remi@fedoraproject.org> 7.1.0-0.10.RC3Remi Collet <remi@fedoraproject.org> 7.1.0-0.9.RC3Remi Collet <remi@fedoraproject.org> 7.1.0-0.8.RC2Remi Collet <remi@fedoraproject.org> 7.1.0-0.8.RC1Remi Collet <remi@fedoraproject.org> 7.1.0-0.7.beta2Remi Collet <remi@fedoraproject.org> 7.1.0-0.6.beta1Remi Collet <remi@fedoraproject.org> 7.1.0-0.5.alpha3Remi Collet <remi@fedoraproject.org> 7.1.0-0.4.alpha2Remi Collet <remi@fedoraproject.org> 7.1.0-0.3.alpha2Remi Collet <remi@fedoraproject.org> 7.1.0-0.2.alpha2Remi Collet <remi@fedoraproject.org> 7.1.0-0.1.alpha1Remi Collet <remi@fedoraproject.org> 7.0.7-1Remi Collet <remi@fedoraproject.org> 7.0.7-0.1.RC1Remi Collet <remi@fedoraproject.org> 7.0.6-3Remi Collet <remi@fedoraproject.org> 7.0.6-2Remi Collet <remi@fedoraproject.org> 7.0.6-0.2.RC1Remi Collet <remi@fedoraproject.org> 7.0.5-2Remi Collet <remi@fedoraproject.org> 7.0.5-1Remi Collet <remi@fedoraproject.org> 7.0.5-0.1.RC1Remi Collet <remi@fedoraproject.org> 7.0.4-2Remi Collet <remi@fedoraproject.org> 7.0.4-1Remi Collet <remi@fedoraproject.org> 7.0.4-0.1.RC1Remi Collet <remi@fedoraproject.org> 7.0.3-1Remi Collet <remi@fedoraproject.org> 7.0.3-0.3.20160129gitdd3d10cRemi Collet <remi@fedoraproject.org> 7.0.3-0.2.RC1Remi Collet <remi@fedoraproject.org> 7.0.3-0.1.RC1Remi Collet <remi@fedoraproject.org> 7.0.2-1Remi Collet <remi@fedoraproject.org> 7.0.2-0.1.RC1Remi Collet <remi@fedoraproject.org> 7.0.1-1Remi Collet <remi@fedoraproject.org> 7.0.1-0.1.RC1Remi Collet <remi@fedoraproject.org> 7.0.0-2Remi Collet <remi@fedoraproject.org> 7.0.0-1Remi Collet <remi@fedoraproject.org> 7.0.0-0.26.RC8Remi Collet <remi@fedoraproject.org> 7.0.0-0.25.RC8Remi Collet <remi@fedoraproject.org> 7.0.0-0.24.RC7Remi Collet <remi@fedoraproject.org> 7.0.0-0.23.RC7Remi Collet <remi@fedoraproject.org> 7.0.0-0.22.RC6Remi Collet <remi@fedoraproject.org> 7.0.0-0.21.RC5Remi Collet <remi@fedoraproject.org> 7.0.0-0.20.RC5Remi Collet <remi@fedoraproject.org> 7.0.0-0.19.RC5Remi Collet <remi@fedoraproject.org> 7.0.0-0.18.RC4Remi Collet <remi@fedoraproject.org> 7.0.0-0.17.RC3Remi Collet <remi@fedoraproject.org> 7.0.0-0.16.RC3Remi Collet <remi@fedoraproject.org> 7.0.0-0.15.RC2Remi Collet <remi@fedoraproject.org> 7.0.0-0.14.RC1Remi Collet <remi@fedoraproject.org> 7.0.0-0.13.beta3Remi Collet <remi@fedoraproject.org> 7.0.0-0.12.beta2Remi Collet <remi@fedoraproject.org> 7.0.0-0.11.beta1Remi Collet <remi@fedoraproject.org> 7.0.0-0.10.alpha2Remi Collet <remi@fedoraproject.org> 7.0.0-0.9.20150617git3697f02Remi Collet <remi@fedoraproject.org> 7.0.0-0.9.20150611git8cfe282Remi Collet <remi@fedoraproject.org> 7.0.0-0.8.alpha1Remi Collet <remi@fedoraproject.org> 7.0.0-0.7.20150602git8a089e7Remi Collet <remi@fedoraproject.org> 7.0.0-0.7.20150525git6f46fa3Remi Collet <remi@fedoraproject.org> 7.0.0-0.6.20150525git404360fRemi Collet <remi@fedoraproject.org> 7.0.0-0.6.20150518gitcee8857Remi Collet <remi@fedoraproject.org> 7.0.0-0.6.20150515gitc9f27eeRemi Collet <remi@fedoraproject.org> 7.0.0-0.6.20150507gitdd0b602Remi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150428git94f0b94Remi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150427git1a4d3e4Remi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150418git1f0a624Remi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150416gitc77d97fRemi Collet <remi@fedoraproject.org> 7.0.0-0.5.20150403gitadcf0c6Remi Collet <remi@fedoraproject.org> 7.0.0-0.4.20150331git463ca30Remi Collet <remi@fedoraproject.org> 7.0.0-0.3.20150325git2fe6acdRemi Collet <remi@fedoraproject.org> 7.0.0-0.2.20150325git23336d7Remi Collet <remi@fedoraproject.org> 7.0.0-0.1.20150325git23336d7Remi Collet <remi@fedoraprojec�x��������������������X
inG?<pbr���������������Ğt.or�$T����������������
ĞÞŞ
�e.com>Tor Didriksen <tor.didriksen@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Daniel Fischer <daniel.fischer@oracle.com>Chuck Bell <chuck.bell@oracle.com>Sunanda Menon <sunanda.menon@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Georgi Kodinov <georgi.godinov@oracle.com>Georgi Kodinov <georgi.godinov@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@sun.com>Jonathan Perkin <jonathan.perkin@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Magnus Blaudd <mvensson@mysql.com>Alexander Nozdrin <alexander.nozdrin@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent.boortz@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Timothy Smith <tim@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Daniel Fischer <df@mysql.com>Daniel Fischer <df@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Jim Winstead <jimw@mysql.com>Jim Winstead <jimw@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Kristian Nielsen <knielsen@mysql.com>Kent Boortz <kent@mysql.com>Rodrigo Novo <rodrigo@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Lenz Grimmer <lenz@grimmer.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Joerg Bruehe <joerg@mysql.com>Guilhem Bichot <guilhem@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Petr Chardin <petr@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Petr Chardin <petr@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>MontyMontyMontyTim Smith <tim@mysql.com>David Axmark <davida@mysql.com>David Axmark <davida@mysql.com>David Axmark <davida@mysql.com>David Axmark <david@detron.se>David Axmark <david@detron.se>David Axmark <david@detron.se>- Added RocksDB- fix license field- Provide my.cnf for all systems- Include mysql-keyring directory
- Provide keyrin�x�������������X��������X
li�?POSI��������ȷ�������_I te�$����������������
�_�_
�E
a�?
\pd
�
�
�
� 
�	$
�	a
�
�
�
�
�
�
�
�
�#
�	A
�M
�k
�q
x�	�
��`
h���
�
$4�(�
8�x9�x:�[xG
X�H
X�I
X�X
X�
Y
X�
\
X�]
Y^
Ypb
Y�
d
[7
e
[<
f
[?
l
[A
t
[\u
[|v
[��
\ 
�
\$
�
\*
�
\l



\�


\�6

^�

^�6


a


a)
�
al


ap
ax
g
a|
h
a�
Cdhcp-common4.3.650.el8_10Common files used by ISC dhcp client, server and relay agentDHCP (Dynamic Host Configuration Protocol) is a protocol which allows
individual devices on an IP network to get their own network
configuration information (IP address, subnetmask, broadcast address,
etc.) from a DHCP server. The overall purpose of DHCP is to make it
easier to administer a large network.

This package provides common files used by dhcp and dhclient package.f�Hord1-prod-x86build004.svc.aws.rockylinux.org��KojiRockyISCinfrastructure@rockylinux.orgUnspecifiedhttp://isc.org/products/DHCP/linuxnoarch|�6���WA큤����A큤����f�YwK�YwKNYwJ*f�YwJ*f�f�e2003e03b9f5c378adf3cbd557d00e4c26725c640fdcda065663a869bcf39373b30c8108c1ac7a26ed1840019789de4e703197af1c01eee7c4105ab4edd3f49d8d10ee459e71d46b9dc3057bc0273c71b15df6e90f83c87fb0423ed440389b66dd7ae2201c0c11c3c1e2510d731c67b2f4bc8ba735707d7348ddd65f7b5985629e1a228f57dba86d340d71fbe7bade8353d1464d75dac57d99a757ae79e2f48807679cbc0f03d0ccb93821208e08af05d4bf83ada05a12331f4edcb1fbac75bb�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootdhcp-4.3.6-50.el8_10.src.rpm��������������������������������dhcp-common







rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.14.3fh@e�	@cEZ�bzS�a���a�*@`���_�_@_�G@_��@^���]��]��]��@]�*�]��@]��@\�\@\��\��@\��[��@[��@[P}@['��[�[�@[�@Z��Z�I@Z�w@Z��@Z���Z���Z���Z���Zz�@Zu�@ZV@Z:P�Z*~�ZC@Y�X@Y�)@Y�m@Yy�Yx�@Yh�@Y_w�YZ1�Y.�@Y$$@X�Q@X�X��@X>�@W��@W֘�W��WF�@W#L�V�@V��V�<@VqR@Vn�@VTQ@VR��V8��V�@V�@V
B�U�|@U�U��UȒ@U�K@U���U�b@U�'�U���U�a@Ud`@U6;�U+��U�@U�@T�E@T�@T�@T�-@T�-@T��@T�O�Tи@T�f�T�Z@T���T�p@Tl�@T`��TX��TSy�T7�@T5'@T.��TT@T_�T
��S�v�S�%@S�G�S�S�S�
�S��@S�R@S��S��@S��@S���S�r�S�!@S��Sj @S(5@S��Sn�S��S��SK@S
��S
��R��@R��@R�R�R�a@R��@R��@R��R���R��@RrF@Ri�RR�@REs@R9��R8D@R1��RC@Q�B@Q�Y@Q��@Q��Q�K�Q��Q�'@Q�@Qm=@Q\�QQ��Q']�Q�@Q
"@P��P�9@P��P�@P�!@P��P��P���P�Y�P�*�P�{@P~��Pv��Pt�Pb�@PQ�P7l�P4�P2&�P.2@P��P��P�P�P
<�P
<�P�@O��O�@O�F@O��O�t@O��@O��@O��@O�8�O���O�	�Ou�@Ole�Ole�Oi�Oi�Oi�OD�O8�@O1@O))@O'�Ob�O�O�N��@N�x�N�'@N�@N�1�N��N�@N��@N��@N�
@N�
@N�j@N���N��@N�]�N{#@Ny�Nw.�Ni��Ni��NW��NNP@NE�NC�@NBr�N-Z�N$ @N
��M�A�M��@M�c@M��M��@M��@M�@M�U�M�U�M���Mt�Mn1@Md��MbS�MQ0@MF�@MB��MA^@M.�@M!�@M��M��M
�L�!�L�L�f�L�7�L��LҠ@L��L��L��L��@L��@L��@L���L�{�L�)@L��L~@@L|�Lnn@LR��LF�@L;�L,�@L)�@L�@K޺�K�t�K�#@K�#@K��K�E�K�P@K���K�g@K�,�K�f@K�q�K~}@K~}@K}+�Kz��Kz��Ko��Kl@Kie@Kh�KV�@KTM@KPX�KE�K&(�K
y@J��@J�k�J�_@J�j�J�v@J�#�J�#�J��@J���J�Q�J���Jz�Jyt@Jyt@Ji�@JhP�JU�JU�JKO�JD�@J
{�I�c�I�c�I��I�)@I�@IԨ�I��I���I��I���I��@I��@I��@I�U@Io%@Il�@Ii�@Ih��IcG�IJ;@IJ;@I6t�IP@Ig@H�f@H��H��H��H��@Hϟ�H��H��x�������������К�������X
2c�?5ae8��������8��4b70�$i����������������
�4�4�4
�sable libdaemon_example and ftexample plugins.- Update variable used for mysql-test suite location to match source.- Correct yesterday's fix, so that it also works for the last flag,
  and fix a wrong quoting: un-quoted quote marks must not be escaped.- Removed "mysql_upgrade_shell"
- Removed some copy/paste between debug and normal build- Modify CFLAGS and CXXFLAGS such that a debug build is not optimized.
  This should cover both gcc and icc flags.  Fixes bug#40546.- Removed the "Federated" storage engine option, and enabled in all- Get rid of the "warning: Installed (but unpackaged) file(s) found:"
  Some generated files aren't needed in RPMs:
  - the "sql-bench/" subdirectory
  Some files were missing:
  - /usr/share/aclocal/mysql.m4  ("devel" subpackage)
  - Manual "mysqlbug" ("server" subpackage)
  - Program "innochecksum" and its manual ("server" subpackage)
  - Manual "mysql_find_rows" ("client" subpackage)
  - Script "mysql_upgrade_shell" ("client" subpackage)
  - Program "ndb_cpcd" and its manual ("ndb-extra" subpackage)
  - Manuals "ndb_mgm" + "ndb_restore" ("ndb-tools" subpackage)- Made the "Federated" storage engine an option
- Made the "Cluster" storage engine and sub packages an option- Add the man pages for "ndbd" and "ndb_mgmd".- Require a manual upgrade if the alread-installed mysql-server is
  from another vendor, or is of a different major version.- "ndb_size.tmpl" is not needed any more,
  "man1/mysql_install_db.1" lacked the trailing '*'.- Removed man page for "mysql_create_system_tables"- Add debug server.- Remove Max RPMs; the server RPMs contain a mysqld compiled with all
  features that previously only were built into Max.- Add several man pages for NDB which are now created.- Put back "libmygcc.a", found no real reason it was removed.

- Add CFLAGS to gcc call with --print-libgcc-file, to make sure the
  correct "libgcc.a" path is returned for the 32/64 bit architecture.- Fix the move of "mysqlmanager" to section 8: Directory name was wrong.- Include the new man pages for "my_print_defaults" and "mysql_tzinfo_to_sql"
  in the server RPM.
- The "mysqlmanager" man page got moved from section 1 to 8.- Call "make install" using "benchdir_root=%{_datadir}",
  because that is affecting the regression test suite as well.- Explicitly note that the "MySQL-shared" RPMs (as built by MySQL AB)
  replace "mysql-shared" (as distributed by SuSE) to allow easy upgrading
  (bug#22081).- Add "--with-partition" t 2006 Joerg Bruehe <joerg@mysql.com>

- Use the Perl script to run the tests, because it will automatically check
  whether the server is configured with SSL.- move "mysqldumpslow" from the client RPM to the server RPM (bug#20216)

- Revert all previous attempts to call "mysql_upgrade" during RPM upgrade,
  there are some more aspects which need to be solved before this is possible.
  For now, just ensure the binary "mysql_upgrade" is delivered and installysql.com>

- To run "mysql_upgrade", we need a running server;
  start it in isolation and skip password checks.- Always compile for PIC, position independent code.- Use character set "all" when compiling with Cluster, to make Cluster
  nodes independent on the character set directory, and the problem
  that two RPM sub packages both wants to install this directory.- Use "./libtool --mode=execute" instead of searching for the
  executable in current directory and ".libs".- Install and run "mysql_upgrade"- Remove sql-bench, and MySQL-bench RPM (will be built as an independent
  project from the mysql-bench repository)- Remove old mysqltestmanager and related programs- Set $LDFLAGS from $MYSQL_BUILD_LDFLAGS- Changed product name from "Community Edition" to "Community Server"- Fast mutexes is now disabled by default, but should be
  used in Linux builds.- Reintroduced a max build
- Limited testing of 'debug' and 'max' servers
- Berkeley DB only in 'max'- Use "-i" on "make test-force";
  this is essential for later evaluation of this log file.- Pass '-static' to libtool, link static with our own libr�x�������������H��������X
 3:?1. F�����������	upda�$J����������������
�	�	�	
�]]]]]]FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF^^^^^^^______^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF`````````````FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFaaaaaaFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFbFFFFFFFFFFFFFFFFcccccccccFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFdddddddeeeeeedddFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFffffffffffffffffffffffffffffgggggggggggggggggggggggggggggggggggggggggggggfffFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFhhhhhhhhhhhhhhhhhhFFFFiiiijjjjjjjjjjjjjjjjjjjjjjjjikkkkkkkkkkkkkkkillllllimmmmmmmmmmmmmmmmmmFFFFFFFFFnooopqrstpython2.7pyconfig-64.h.build-id008282c87803bbcb8a5c42aeb7aa2676c46a67f9e16501257237d2ba57ac5da9946563a69a39120421788e62a2a44daf219b6f1fbbf5279ebacfa50886490c57f3eaeddd4d3e6940946a7e044dda480c47a182675ba74f79db70cbfba925f36139ce4e0d67e4931a2ef85a5189c87c029cbceb159c2a4210237a1607a7601a9bf2ad3edfafbca7714912831165b55fb9774c16778d2ea098ec776ed3a50acf13053cd81fffd136260bbf42f66aecfd6202134918f4dfe931f361519a7979f342c44fa7f81239d219380bb33878e3e740851f6b1d2573038900cfadfafbaf6d5838476cf17c3e036b8afc8819a13d1f979ac5dd89c7f8626aafd2543295f96c13a62021a1274b0df81054428f1c33bc791fa39073d8362bf422c55edaeb1b331e25f515a163f6fb1d27fb2c187b533cdc05165361832229e7f081414f88d12d2c7c07eedbd92dc4da4cbc617c686fd41071372eb2c608b2e5f4777c32b844a12d22b1c6771f2c2f2ba6eb7b4b2781f1b291df9c0e7fbd2df1848b3be855c078dc0d66c0d8c5eb3838408d978a5d543f9341f47a0c720f7cd82281108fb63f3a5dd09fa8f71cf1179125f132d70905bf767d64d65a0c44107fe3f2e34c76c0a382760420ea3ca825aa638c85d0b4a56d50294d8f87bf91d4d40705a52446b623434205afe6ae83772772f9e565ae35e8e647649f8b44e950a67d9762b0531daa61518045106ae6e1f20092c2adb04bfc26167e0fc947146a4a954494e9d02d2c16a72f3cc23ec02d778665814df61b64b3750bcff78a48cb20d8c2924a9d4e344eed830f66d9217182ecfec273f4b74fed29cc4352ddded380f5f62b2c00fcea470b63e79b4ddf465726abe7ccdf3b1b6d2a75f9d0203930fb053f83595f70c423c7a2f4619fdb6b5c5ec9cfe6c80e4b5b30e11eb1c1d9fa4d50eb7cabaa8cef70cb44d85cf580f271ef5c6288abad70fb3ee884280d62075e21b1321081716448afbf7a4d8b7e714014bd7f609c39c5fa8f1c5f6619cda34879bf6644ecb1946234fc79f1bb957a4dd247892681825ff81d6ea06643447020567c743f5cbc95f13ed3d312c5�x��������������y�������X
ea�?x foP
��������hrefe�$q����������������
�h�h�h
�����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������platform-python-setuptoolspython3.6dist(setuptools)python3dist(setuptools)@









python(abi)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.63.0.4-14.6.0-14.0.4-14.0-15.2-1python3-setuptools39.2.0-4.el8_104.14.3hR�@f��c���^{G�\�@[ͻ�[0�@[,�[(�@[@Z���Z��Z}�@Z]�@Z]�@ZKt@Z@Z@ZC@Y�y�Y��@Y��@Y��@Y���Yy�Yj�YBv�Y)j@X��@X�[�X�q�X��X��@X��@Xk�@Xd��Xc�@X]�XO�XM?�XJ��XJ��X#�X2@XI@X�W��W�W�W�W�@W�0@W��W���W�@W�E@W��W�\@W�
�W�@WzO�WaC@WV�@WP�WM|�WJ�W!�@W)@W�V�@V���V�J�Vя�V��V��@V��@V��@V��V��@V�@V�@V��V��V���Vs�@Vp�Vl@Va�@VU��VHs�V<�@V8��V�@V�@V
B�U�|@U���U�3@U��@U�U�U���Ux&�Ut2@Ui�@UY�@U>$�U�@U��U
]@U�Ut@Ut@T���T�E@T�\@T�C@T��T��T�+@T�M�TH�T;��T9�T.��T&��S�Q@S�Q@S�Q@S���SZN@SX��SW�@R���R�
@R{��Rw�@RnQ�Rk��Q�B@Q�p@Q�5�Qֵ@Q�@Q���Qf��Q�P�@P�@P
<�P
��O��O�O�E@On@N��NP�@N�@Mc�@Mc�@MR��Lq@La?@LH2�LH2�LF�@LF�@L/&@L�L�L�L�Kj��Kb�Kb�K^�@KY�@K&(�K$�@K
>�J�@J�@J�`@J�@JlE@J\s@I��@Tomáš Hrnčiar <thrnciar@redhat.com> - 39.2.0-9Lumír Balhar <lbalhar@redhat.com> - 39.2.0-8Charalampos Stratakis <cstratak@redhat.com> - 39.2.0-7Charalampos Stratakis <cstratak@redhat.com> - 39.2.0-6Petr Viktorin <pviktori@redhat.com> - 39.2.0-5Lumír Balhar <lbalhar@redhat.com> - 39.2.0-4Petr Viktorin <pviktori@redhat.com> - 39.2.0-3Petr Viktorin <pviktori@redhat.com> - 39.2.0-2Charalampos Stratakis <cstratak@redhat.com> - 39.2.0-1Petr Viktorin <pviktori@redhat.com> - 39.0.1-2Charalampos Stratakis <cstratak@redhat.com> - 39.0.1-1Tomas Orsava <torsava@redhat.com> - 38.4.0-4Fedora Release Engineering <releng@fedoraproject.org> - 38.4.0-3Troy Dawson <tdawson@redhat.com> - 38.4.0-2Charalampos Stratakis <cstratak@redhat.com> - 38.4.0-1Charalampos Stratakis <cstratak@redhat.com> - 38.2.5-1Miro Hrončok <mhroncok@redhat.com> - 37.0.0-1Miro Hrončok <mhroncok@redhat.com> - 36.5.0-1Tomas Orsava <torsava@redhat.com> - 36.2.0-8Tomas Orsava <torsava@redhat.com> - 36.2.0-7Tomas Orsava <torsava@redhat.com> - 36.2.0-6Tomas Orsava <torsava@redhat.com> - 36.2.0-5Tomas Orsava <torsava@redhat.com> - 36.2.0-4Michal Cyprian <mcyprian@redhat.com> - 36.2.0-3Fedora Release Engineering <releng@fedoraproject.org> - 36.2.0-2Charalampos Stratakis <cstratak@redhat.com> - 36.2.0-1Charalampos Stratakis <cstratak@redhat.com> - 36.0.1-1Kevin Fenzi <kevin@scrye.com> - 35.0.2-1Kevin Fenzi <kevin@scrye.com> - 35.0.1-1Kevin Fenzi <kevin@scrye.com> - 34.3.2-1Kevin Fenzi <kevin@scrye.com> - 34.3.0-1Michal Cyprian <mcyprian@redhat.com> - 34.2.0-2Charalampos Stratakis <cstratak@redhat.com> - 34.2.0-1Kevin Fenzi <kevin@scrye.com> - 34.1.1-1Michal Cyprian <mcyprian@redhat.com> - 32.3.1-2Kevin Fenzi <kevin@scrye.com> - 32.3.1-1Kevin Fenzi <kevin@scrye.com> - 32.3.0-1Kevin Fenzi <kevin@scrye.com> - 32.2.0-1Stratakis Charalampos <cstratak@redhat.com> - 30.4.0-2Kevin Fenzi <kevin@scrye.com> - 30.4.0-1Charalampos Stratakis <cstratak@redhat.com> - 28.8.0-3Charalampos Stratakis <cstratak@redhat.com> - 28.8.0-2Kevin Fenzi <kevin@scrye.com> - 28.8.0-1Kevin Fenzi <kevin@scrye.com> - 28.7.1-1Kevin Fenzi <kevin@scrye.com> - 28.6.1-1Kevin Fenzi <kevin@scrye.com> - 28.6.0-1Kevin Fenzi <kevin@scrye.com> - 28.3.0-1Kevin Fenzi <kevin@scrye.com> - 28.2.0-1K�x�������������8i�������X
ir?uff ��������C- fi�$����������������
CCC
�e libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5
- make php-recode optionnal, not available on RHEL-5
- disable t1lib on RHEL-5- enable tidy on RHEL-6 only
- re-enable unit tests- minor macro fixes for RHEL-5 build
- update autotools workaround for RHEL-5
- use readline when libedit not available (RHEL-5)- update to 5.4.8
- define both session.save_handler and session.save_path
- fix possible segfault in libxml (#828526)
- use SKIP_ONLINE_TEST during make test
- php-devel requires pcre-devel and php-cli (instead of php)
- provides php-phar
- update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed
- php-cli: provides cli command in standard root (scl)- add configtest option to init script
- test configuration before service reload
- fix php-fpm service relocation
- fix php-fpm config relocation
- drop embdded subpackage for scl- missing requires on scl-runtime
- relocate /var/lib/session
- fix php-devel requires
- rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp
- php-fpm: new systemd macros (#850268)
- php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085
- no odbc call during timeout, https://bugs.php.net/63171
- check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini
  move it to apache and php-fpm configuration files- update to 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386)
- use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt fo�x��������������X�������X
e �?nsioh�I������K�move�$[����������������
K�J�L�
�Kent Boortz <kent@mysql.com>Daniel Fischer <df@mysql.com>Daniel Fischer <df@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Jim Winstead <jimw@mysql.com>Jim Winstead <jimw@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Kristian Nielsen <knielsen@mysql.com>Kent Boortz <kent@mysql.com>Rodrigo Novo <rodrigo@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Lenz Grimmer <lenz@grimmer.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Joerg Bruehe <joerg@mysql.com>Guilhem Bichot <guilhem@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Petr Chardin <petr@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Petr Chardin <petr@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>MontyMontyMontyTim Smith <tim@mysql.com>David Axmark <davida@mysql.com>David Axmark <davida@mysql.com>David Axmark <davida@mysql.com>David Axmark <david@detron.se>David Axmark <david@detron.se>David Axmark <david@detron.se>- Added RocksDB- fix license field- Provide my.cnf for all systems- Include mysql-keyring directory
- Provide keyring_file.so plugin- Fix for centos6 to write temp pass into log file instead of stdout (#1541769)- Re-added TokuBackup to the packaging (JEN-439)- Initial release PS 5.7.10-1rc1- Updated for 5.7.9
- Added libtest_* plugins to test package subpackage
- Add mysqlpump man page
- Obsolete mysql-connector-c-shared dependencies- Add support for pkg-config- Added libtest_framework.so, libtest_services.so, libtest_services_threaded.so plugins
- Build and ship mecab plugin- Include boost sources
- Fix cmake buildrequires
- Fix build on el5 with gcc44
- Add license info in each subpackage
- Soname bump, more compat packages
- Updated default shell for mysql user
- Added mysql_ssl_rsa_setup
- Include mysql-files directory- Provide replication_observers_example_plugin.so plugin- Updated for 5.7.6- Provide mysql_no_login.so plugin- Provide mysql-compat-server dependencies- Remove perl(GD) and dtrace dependencies- Resolve embedded-devel conflict issue- Add bench package
- Enable dtrace- Updated for 5.7.5- Fix Cflags for el7- Support for enterprise packages
- Upgrade from MySQL-* packages- Resolve conflict with mysql-libs-compat- Resolve conflict issues during upgrade
- Add ha_example.so plugin which is now included- 5.7.4
- Enable shared libmysqld by cmake option
- Move mysqltest and test plugins to test subpackage- Fixed isa_bits error- Initial 5.7 port- Fixed uln advanced rpm libyassl.a error
- Updated to 5.6.15- Fixed mysql_install_db usage 
- Improved handling of plugin directo�x�������������(H�������X
EW�?ADME��ȯ	�.mo�$M����������������
���
�ory if we read a zero-length input token (RT#7794, part of
  - pull in fix from master to ignore an empty token from an acceptor if
  we've already finished authenticating (RT#7797, part of #1043962)
- pull in fix from master to avoid a memory leak when a mechanism's
  init_sec_context function fails (RT#7803, part of #1043962)
- pull in fix from master to avoid a memory leak in a couple of error
  cases which could occur while obtaining acceptor credentials (RT#7805, part
  of #1043962)- update to 1.12 final- update to beta2
  - drop obsolete backports for storing KDC time offsets and expiration times
    in keyring credential caches- rebase to master
- update to beta1
  - drop obsolete backport of fix for RT#7706- pull in fix to store KDC time offsets in keyring credential caches (RT#7768,
  - pull in fix to set expiration times on credentials stored in keyring
  credential caches (RT#7769, #1031724)- update to 1.11.4
  - drop patch for RT#7650, obsoleted
  - drop patch for RT#7706, obsoleted as RT#7723
  - drop patch for CVE-2013-1418/CVE-2013-6800, included in 1.11.4- switch to the simplified version of the patch for #1029110 (RT#7764)- check more thoroughly for errors when resolving KEYRING ccache names of type
  "persistent", which should only have a numeric UID as the next part of the
  name (#1029110)- incorporate upstream patch for remote crash of KDCs which serve multiple
  realms simultaneously (RT#7756, CVE-2013-1418/CVE-2013-6800,- drop patch to add additional access() checks to ksu - they add to breakage
  when non-FILE: caches are in use (#1026099), shouldn't be resulting in any
  benefit, and clash with proposed changes to fix its cache handling- add some minimal description to the top of the wrapper scripts we use
  when starting krb5kdc and kadmind to describe why they exist (tooling)- initial update to alpha1
  - drop backport of persistent keyring support
  - drop backport for RT#7689
  - drop obsolete patch for fixing a use-before-init in a test program
  - drop obsolete patch teaching config.guess/config.sub about aarch64-linux
  - drop backport for RT#7598
  - drop backport for RT#7172
  - drop backport for RT#7642
  - drop backport for RT#7643
  - drop patches from master to not test GSSRPC-over-UDP and to not
    depend on the portmapper, which are areas where our build systems
    often give us trouble, too; obsolete
  - drop backports for RT#7682
  - drop backport for RT#7709
  - drop backport for RT#7590 and partial backport for RT#7680
  - drop OTP backport
  - drop backports for RT#7656 and RT#7657
- BuildRequires: libedit-devel to prefer it
- BuildRequires: pkgconfig, since configure uses it- create and own /etc/gss (#1019937)- pull up fix for importing previously-exported credential caches in the
  gssapi library (RT# 7706, #1019420)- backport the callback to use the libkrb5 prompter when we can't load PEM
  files for PKINIT (RT#7590, includes part of #965721/#1016690)
- extract the rest of the fix #965721/#1016690 from the changes for RT#7680- fix trigger scriptlet's invocation of sed (#1016945)- rebuild with keyutils 1.5.8 (part of #1012043)- switch to the version of persistent-keyring that was just merged to
  master (RT#7711), along with related changes to kinit (RT#7689)
- go back to setting default_ccache_name to a KEYRING type- pull up fix for not calling a kdb plugin's check-transited-path
  method before calling the library's default version, which only knows
  how to read what's in the configuration file (RT#7709, #1013664)- configure --without-krb5-config so that we don't pull in the old default
  ccache name when we want to stop setting a default ccache name at configure-
  time- fix broken dependency on awk (should be gawk, rdieter)- add missing dependency on newer keyutils-libs (#1012034)- back out setting default_ccache_name to the new default for now, resetting
  it to the old default while the kernel/keyutils bits get sorted (sgallagh)- add explicit build-time dependency on a version of keyutils that's new
  enough to includ�x��������������7�������X
hc�?ient��	P��onfi�$y����������������
���
�at.com> - 1.15.1-24Robbie Harwood <rharwood@redhat.com> - 1.15.1-23Robbie Harwood <rharwood@redhat.com> - 1.15.1-22Robbie Harwood <rharwood@redhat.com> - 1.15.1-20Robbie Harwood <rharwood@redhat.com> - 1.15.1-19Fedora Release Engineering <releng@fedoraproject.org> - 1.15.1-18Robbie Harwood <rharwood@redhat.com> - 1.15.1-17Robbie Harwood <rharwood@redhat.com> - 1.15.1-16Robbie Harwood <rharwood@redhat.com> - 1.15.1-15Robbie Harwood <rharwood@redhat.com> - 1.15.1-14Robbie Harwood <rharwood@redhat.com> - 1.15.1-13Robbie Harwood <rharwood@redhat.com> - 1.15.1-12Robbie Harwood <rharwood@redhat.com> - 1.15.1-11Robbie Harwood <rharwood@redhat.com> - 1.15.1-10Robbie Harwood <rharwood@redhat.com> - 1.15.1-9Robbie Harwood <rharwood@redhat.com> - 1.15.1-8Robbie Harwood <rharwood@redhat.com> - 1.15.1-7Robbie Harwood <rharwood@redhat.com> - 1.15.1-6Robbie Harwood <rharwood@redhat.com> - 1.15.1-5Robbie Harwood <rharwood@redhat.com> - 1.15.1-4Robbie Harwood <rharwood@redhat.com> - 1.15.1-3Robbie Harwood <rharwood@redhat.com> - 1.15.1-2Robbie Harwood <rharwood@redhat.com> - 1.15.1-1Robbie Harwood <rharwood@redhat.com> - 1.15-9Robbie Harwood <rharwood@redhat.com> - 1.15-8Robbie Harwood <rharwood@redhat.com> - 1.15-7Robbie Harwood <rharwood@redhat.com> - 1.15-6Robbie Harwood <rharwood@redhat.com> - 1.15-5Robbie Harwood <rharwood@redhat.com> - 1.15-4Robbie Harwood <rharwood@redhat.com> - 1.15-beta2-3Robbie Harwood <rharwood@redhat.com> - 1.15-beta1-2Robbie Harwood <rharwood@redhat.com> - 1.15-beta1-1Tomáš Mráz <tmraz@redhat.com> - 1.14.4-6Robbie Harwood <rharwood@redhat.com> - 1.14.4-5Robbie Harwood <rharwood@redhat.com> - 1.14.4-4Robbie Harwood <rharwood@redhat.com> - 1.14.4-3Robbie Harwood <rharwood@redhat.com> - 1.14.4-2Robbie Harwood <rharwood@redhat.com> - 1.14.4-1Robbie Harwood <rharwood@redhat.com> - 1.14.3-9Robbie Harwood <rharwood@redhat.com> - 1.14.3-8Robbie Harwood <rharwood@redhat.com> - 1.14.3-7Robbie Harwood <rharwood@redhat.com> - 1.14.3-6Robbie Harwood <rharwood@redhat.com> - 1.14.3-5Robbie Harwood <rharwood@redhat.com> - 1.14.3-4Robbie Harwood <rharwood@redhat.com> - 1.14.3-3Robbie Harwood <rharwood@redhat.com> - 1.14.3-2Robbie Harwood <rharwood@redhat.com> - 1.14.3-1Robbie Harwood <rharwood@redhat.com> - 1.14.1-9Robbie Harwood <rharwood@redhat.com> - 1.14.1-8Robbie Harwood <rharwood@redhat.com> - 1.14.1-7Robbie Harwood <rharwood@redhat.com> - 1.14.1-6Robbie Harwood <rharwood@redhat.com> - 1.14.1-5Robbie Harwood <rharwood@redhat.com> - 1.14.1-4Robbie Harwood <rharwood@redhat.com> - 1.14.1-3Robbie Harwood <rharwood@redhat.com> - 1.14.1-2Robbie Harwood <rharwood@redhat.com> - 1.14.1-1Robbie Harwood <rharwood@redhat.com> - 1.14-23Robbie Harwood <rharwood@redhat.com> - 1.14-22Robbie Harwood <rharwood@redhat.com> - 1.14-21Fedora Release Engineering <releng@fedoraproject.org> - 1.14-20Robbie Harwood <rharwood@redhat.com> - 1.14-19Robbie Harwood <rharwood@redhat.com> - 1.14-18Robbie Harwood <rharwood@redhat.com> - 1.14-17Robbie Harwood <rharwood@redhat.com> - 1.14-16Robbie Harwood <rharwood@redhat.com> - 1.14-15Robbie Harwood <rharwood@redhat.com> - 1.14-14Robbie Harwood <rharwood@redhat.com> - 1.14-13Robbie Harwood <rharwood@redhat.com> - 1.14-12Robbie Harwood <rharwood@redhat.com> - 1.14-11Robbie Harwood <rharwood@redhat.com> - 1.14-10Robbie Harwood <rharwood@redhat.com> - 1.14-9Robbie Harwood <rharwood@redhat.com> - 1.14-beta2-8Robbie Harwood <rharwood@redhat.com> - 1.14-beta1-7Robbie Harwood <rharwood@redhat.com> - 1.14-beta1-6Robbie Harwood <rharwood@redhat.com> - 1.14-beta1-5Robbie Harwood <rharwood@redhat.com> - 1.14-beta1-4Robbie Harwood <rharwood@redhat.com> - 1.14-beta1-3Robbie Harwood <rharwood@redhat.com> - 1.14-beta1-2Robbie Harwood <rharwood@redhat.com> - 1.14-beta1-1Robbie Harwood <rharwood@redhat.com> - 1.13.2-13Robbie Harwood <rharwood@redhat.com> - 1.13.2-12Robbie Harwood <rharwood@redhat.com> - 1.13.2-11Robbie Harwood <rharwood@redhat.com> - 1.13.2-10Robbie Harwood <rharwood@redhat.com> - 1.13.2-9Rob�x�������������'�������X
1d�?25e2������HA�������1738�$.����������������
��
:7b59f3ee096a74e843c47a8`�6y�`�6B directory.
- Add "--refresh" functionality to vgchange and vgmknodes.
- Avoid exceeding LV size when wiping device.
- Calculate mirror log size instead of using 1 extent.
- Ensure requested device number is available before activating with it.
- Fix incorrect exit status from 'help <command>'.
- Fix vgrename using UUID if there are VGs with identical names.
- Fix segfault when invalid field given in reporting commands.
- Use better random seed value in temp file creation.
- Add read_urandom to read /dev/urandom. Use in uuid calculation.
- Fix race in vgcreate that would result in second caller overwriting first.
- Fix uninitialised lv_count in vgdisplay -c.
- Don't skip updating pvid hash when lvmcache_info struct got swapped.
- Fix startup race in clvmd.
- Cope with snapshot dependencies when removing a whole VG with lvremove.
- Make man pages and tool help text consistent using | for alternative options.
- Add "all" field to reports expanding to all fields of report type.
- Enforce device name length and character limitations in libdm.- Upstream merge of device-mapper and lvm2 source.
- Correct prototype for --permission on lvchange and lvcreate man pages.
- Exit with non-zero status from vgdisplay if couldn't show any requested VG.
- libdevmapper.pc: Use simplified x.y.z version number.
- Accept locking fallback_to_* options in the global section as documented.
- Several fixes to lvconvert involving mirrors.
- Avoid overwriting in-use on-disk text metadata when metadataarea fills up.
- Generate man pages from templates and include version.
- Fix misleading error message when there are no allocatable extents in VG.
- Fix handling of PVs which reappeared with old metadata version.
- Fix validation of --minor and --major in lvcreate to require -My always.
- Allow lvremove to remove LVs from VGs with missing PVs.
- In VG with PVs missing, by default allow activation of LVs that are complete.
- Require --force with --removemissing in vgreduce to remove partial LVs.
- No longer write out PARTIAL flag into metadata backups.
- Treat new default activation/missing_stripe_filler "error" as an error target.
- Add devices/md_chunk_alignment to lvm.conf.
- Pass struct physical_volume to pe_align and adjust for md chunk size.
- Avoid shuffling remaining mirror images when removing one, retaining primary.
- Prevent resizing an LV while lvconvert is using it.
- Avoid repeatedly wiping cache while VG_GLOBAL is held in vgscan & pvscan.
- Fix pvresize to not allow resize if PV has two metadata areas.
- Fix setting of volume limit count if converting to lvm1 format.
- Fix vgconvert logical volume id metadata validation.
- Fix lvmdump metadata gather option (-m) to work correctly.
- Fix allocation bug in text metadata format write error path.
- Fix vgcfgbackup to properly check filename if template is used.
- vgremove tries to remove lv snapshot first.
- Improve file descriptor leak detection to display likely culprit and filename.
- Avoid looping forever in _pv_analyze_mda_raw used by pvck.
- Change lvchange exit status to indicate if any part of the operation failed.
- Fix pvchange and pvremove to handle PVs without mdas.
- Fix pvchange -M1 -u to preserve existing extent locations when there's a VG.
- Cease recognising snapshot-in-use percentages returned by early devt kernels.
- Add backward-compatible flags field to on-disk format_text metadata.
- libdevmapper: Only resume devices in dm_tree_preload_children if size changes.
- libdevmapper: Extend deptree buffers so the largest possible device numbers fit.
- libdevmapper: Underline longer report help text headings.- Only set exec_prefix once and configure explicit directories to work with
  new version of rpm.- Add BuildRequires on cmanlib-devel. This is required after libcman split
  from cman and cman-devel into cmanlib and cmanlib-devel.
- Make versioned BuildRequires on cman-devel and cmanlib-devel more strict
  to guarantee to get the right version.- Add versioned BuildRequires on new cman-de�x���������������������X
�?����������������
�$]����������������
��
�_mit.solibkadm5clnt_mit.so.12libkadm5clnt_mit.so.12.0libkadm5srv.solibkadm5srv_mit.solibkadm5srv_mit.so.12libkadm5srv_mit.so.12.0/usr/lib//usr/lib/.build-id//usr/lib/.build-id/88//usr/lib/.build-id/fc//usr/lib64/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu







directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=889feba1c1cc1ce3fec20aea047ed966c06ff181, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fc182d950c58c178357f4d6407025306c7c19e82, stripped


RPPPRR
RRRRRRRR	RRRRRRRRR
RRRR
RRPPPR
RRRRRRRRRR	RRRRRRRRRR
RRRR
Rhttps://bugs.rockylinux.orgutf-8e6f496f37256c9685e8e8f5c56003cc8d088312c9853ac5727d1a43105195b3b?���0�|�����cg�AYg����i�3
!pQ�p�)�Tξ7��]�mtZ`h?{9
	�]�mtZ`ُ�'�ʝ f�\�!)N�y$*�����f��@��S#��£�dT�Lh�	��J� �����"��'wF�*ԟ1����{�O��\�pí���-J�/����H>x���G�h$�7�cc����q"�l0OŻ^ܶ�7�z�	H�I��/d��T&���M�U�4k� wwN��3�O&fV�
�4iX��\J<���K��"���`��K���[j��aw�9���)����~bY����d�d��*SА�w���fw�.p�I^	�"�&x?�����
�1l/VU��Y�}�g�_��a��1U?��� C������OD�q�#�2�6�B�߄,HE���h�r�rHrq��D1Ә�G ��ܣ�D�����;$D	���Wb^\��D}���͋�e9��+G�����2����5J��RV᪄��se픒�Q$���jL�qU�.s��w�¡�7�|֍a~�*���Q$\=�G�6uN~xO��g�DI���+�5Z¼�b182a9c06c79497aa1448ece1dbe3a813ba915f98351bb5872fa5874e0571a01b801d799060d4b7e90c7d02be8682f09707da2e3h�T)uDh�Tap-mcpdm: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: sti: sti_uniperif: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: samsung: spdif: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: samsung: s3c24xx-i2s: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: mediatek: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: jz4740: jz4740-i2s: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: cirrus: ep93xx-i2s: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: atmel: atmel_ssc_dai: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: bcm: cygnus-ssp: move .suspend/.resume to component (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: soc-generic-dmaengine-pcm: Fix error handling (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: soc-pcm: crash in snd_soc_dapm_new_dai (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: Intel: cht_bsw_rt5645: Remove unnecessary string buffers and snprintf calls (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: Intel: bytcr_rt5640: Remove unnecessary string buffers and snprintf calls (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: Intel: bytcr_rt5640: Remove code duplication in byt_rt5640_codec_fixup (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: msm8916-wcd-analog: Add MIC BIAS Internal3 (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: msm8916-wcd-analog: Simplify MIC BIAS Internal (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: rt715: fix return value check in rt715_sdw_probe() (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: rt711: fix return value check in rt711_sdw_probe() (Jaroslav Kysela) [1797509]
- [sound] ALSA: ASoC: rt700: fix return value�x��������������������X 
<t�	?redhP��������(5etai�$8����������������
(5'5)5
�22823a09dce810ed8ae48fe16b12b404b36a49971052a7237fc1661d8f3157553e5e37e052690cf735c1f389e5a957fa90e45b1cfd712ab933bba0d82b4d73a802a2fc8ca32fdb6bd1d6d70a4696986d086fddd2c8890366699a6aef1f642c2754bce82b5881b424584f25ddf205e006081d125d1c59c127c7a9a477562c7514ffded2c4578886553f7e51859c78a1e39d863bd5fae8148df14f71526621d76c01e85144224e97765ba7023cec484ede66a2c2acedb4dd73d0e6ec00ed6e7e79763f1e5bf6e2757e9b916d3442384abac760b106dec5784c9465f45d1379f57366c564b65b7f0d0730310602d009f450e553156a9e0c85e2a24481a2b4a1e01c072925b1cfc1c1da4a8b2c66255722c56ed793bc38a1f75ee99ec5f14a21a8665ad353e8c51a2d70dc661cdf2c6f1df086011fbef59464d55394bcece403a6ede7adf3b0667b26082212f0670f978007aca651c60a4a077fd83fea4739ce5126a9952d4242813f070a063b4255a2954615336cd2bdf470c4c96531bcfc127ce23280a00ccb26f7862cd884d26c4c38f55d6ffc36a0401775ee8c10af60368b23ee7b89a8b7867f8c04307e0225f3dc70283d6a940b5f2594581ad92d3a582cb9e86449f3bda1d0a5adee38f9d6fb1e74db505fe2d9238d607aa5199c11589eb84e5e9a2178bb0e36c387183482595ba10fbe6bd81d0da8936cee9731e9993e5bb74d6f75751a7ca4d6ab21bd2bb93e626ab891c230eeedcd20a50f543b6fe9b8a6c312096137b6dc6bb9ab0e13909df0a110fb2a7d5babfd58a3ef287f86b9d1c23ca43b03c1df242fc4f32baa380a26dd2639949e64a93835cc6c3427769207c8f97d429b2516e1be0517c6a50cd8ad17f9afd412f4137b41d82917593970b09f765307fd9d32ce5e6e4811a951e954e493dce91c5a4768aa8fb4b157dd22e654a322fcb63d1eba7c6560313446adf8c468bf625a451dd3500b5ca7c30013abf80c3a1d350511001ec852a9be8965f8050790b28c1a1e65660ef11b055697d63a7d7cb17615c5b4e0b7c7cad45e0ec999e060f20d5b6ce8afc894a2cbf6cab43ba8b949af3b65a647a38cf05a27453f6456165f25ba236e62454c64f821cf1e788b33cd482b43e2cb301a0773365e9fe85f51de8d98408f8c621ce64cb2b3ba6f6c78993a990a1844b07f6b77c01d4c48d58ecc0fac1f47cd189965257da9fa490e6c843e9a60ee3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855cb72a375502fdaf5bfe36af74c9b38606abd20c3d60234216a657d5333d4df59e162fa77130b11633d59af5ffd2a4d6f0710360efa76eb79ce2811707a51a130376e27124ae2ce0b568b901c77533d8026f2a7c986770e6cad3abfc204e4133a8e48cebd5bbc6d2e658c7a2fd8059d592704350c729660e0112934d64a02d11b5d6c7f5a7142bb8b3f180fda6a55b7399c218e4cadb56e8e189b016b3dc80dbb104c5eddd4749418fa57c8b847f9c4863f958f5074508466462977c2a301683092b15833c5f266b10730314284cc150dddc3fb972ae34566496ad917696a5d9781f550cc53cf99487c498cd55f4d3419e58d48b91ae8462adc0501bc035393c774096532994c8bf29cfe512240a9d233ead3379c3ef9ad5466e715f87bd039bdceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f15089614b85dfc9a72c5b2ca33144c1d7e1ed3b1c297459d9fb28a6a5762c2e8d71b057910ae2ed979be3c06446db3d3241c0b595e52983b4c202ad7a6ceec0ee28ad9b9f2a08ea1a2ef90a0aec80c0f3f8d7c961a1242792ab7340b25bb9315e712e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8552837567f76616107e952c98be1ef18d4c60582fab2232a768fb0ea0ce1f1a0c3edd1c6a4ba90df0faf1a6184567fbbb8af74a94f5fcab19d5968bb4be8137273f66a3941dd2e587884071d82768806a2cda436ab6534d1b36ed625182d21592f8e4bb284b82a50644170b3560ccf10272b15eaad4da5cfd1607e3f904ec964f55cf9f83e7cdb4e0d4372acfb9f524cbf974a841e55155ebcdf8184b7149ac2dd2e5a335e7430fc23c7c87c645267922074f7fb6809c9c61765da54017bb08e12b1779e9c6ada244130d88de673c46598d8afcb68cc83bcd6a1a9c37acd98c29f8dbd5292e1aae73253ec5f7d1850148b75501fc19bb01ef344788bb0058053446804b8749c938356ec0f3243091400301fecef3bfe438c81e98be2876e88fb43086d241b9bcbf0eb79d375069435d724915d1562e0e07136fdcd7e94b38b73c3a017eb76fb569fc213c5cdf1fa1da1e88c0752c59d56a09d7f81a985bd09a98f50612df0874fdf135cd8f1983651b8b10be0f2785fe1a7829f3dfd8534741fc239c144026a5ed9a31faf1d0c124e0bc74d17bd75c90a6be595a3956c963eca81afde642bb7864a9398aff96e0b262cce71ccce3979dac2e3b2748f5e45cbcd126e1974e6a49e3bed59c654918c6aef9769bd9eb5dbd67f7e1906ad4cdd0caea782fc96e8cdb7c996c38823f4451f80a5a7bf0ccf962865e3a84fd3ed72f016d3fcaa37d16afa783594794a5ab94193dcb720f503c19ce3d59539c8311189f45390d8247da78b524c10618fd0e857f54f3d97570fe91b5c5513d024ef3faf88b0e99ac01bd7c062f7557b614aff0d21997a06ed962ca185306a91bc0a20bbd87d3cb72d66563064ba7b5e679477046ebf89d8399d940670c8532f3e94a7cb17ea8e086d694ede1708�x����������������������X!
ui�? RebX�������_�x- �$O����������������
_�`�^�
�-3Charalampos Stratakis <cstratak@redhat.com> - 2.7.16-2Charalampos Stratakis <cstratak@redhat.com> - 2.7.16-1Tomas Orsava <torsava@redhat.com> - 2.7.15-21Tomas Orsava <torsava@redhat.com> - 2.7.15-20Tomas Orsava <torsava@redhat.com> - 2.7.15-19Charalampos Stratakis <cstratak@redhat.com> - 2.7.15-18Charalampos Stratakis <cstratak@redhat.com> - 2.7.15-17Lumír Balhar <lbalhar@redhat.com> - 2.7.15-16Tomas Orsava <torsava@redhat.com> - 2.7.15-15Tomas Orsava <torsava@redhat.com> - 2.7.15-14Tomas Orsava <torsava@redhat.com> - 2.7.15-13Petr Viktorin <pviktori@redhat.com> - 2.7.15-12Charalampos Stratakis <cstratak@redhat.com> - 2.7.15-11Miro Hrončok <mhroncok@redhat.com> - 2.7.15-10Tomas Orsava <torsava@redhat.com> - 2.7.15-9Lumír Balhar <lbalhar@redhat.com> - 2.7.15-8Tomas Orsava <torsava@redhat.com> - 2.7.15-7Lumír Balhar <lbalhar@redhat.com> - 2.7.15-6Charalampos Stratakis <cstratak@redhat.com> - 2.7.15-5Lumír Balhar <lbalhar@redhat.com> - 2.7.15-4Tomas Orsava <torsava@redhat.com> - 2.7.15-3Charalampos Stratakis <cstratak@redhat.com> - 2.7.15-2Miro Hrončok <mhroncok@redhat.com> - 2.7.15-1Tomas Orsava <torsava@redhat.com> - 2.7.14-17Miro Hrončok <mhroncok@redhat.com> - 2.7.14-16Miro Hrončok <mhroncok@redhat.com> - 2.7.14-15Charalampos Stratakis <cstratak@redhat.com> - 2.7.14-14Petr Viktorin <pviktori@redhat.com> - 2.7.14-13Florian Weimer <fweimer@redhat.com> - 2.7.14-12Miro Hrončok <mhroncok@redhat.com> - 2.7.14-11Fedora Release Engineering <releng@fedoraproject.org> - 2.7.14-10Petr Viktorin <pviktori@redhat.com> - 2.7.14-9Björn Esser <besser82@fedoraproject.org> - 2.7.14-8Petr Viktorin <pviktori@redhat.com> - 2.7.14-7Miro Hrončok <mhroncok@redhat.com> - 2.7.14-6Charalampos Stratakis <cstratak@redhat.com> - 2.7.14-5Charalampos Stratakis <cstratak@redhat.com> - 2.7.14-4Miro Hrončok <mhroncok@redhat.com> - 2.7.14-3Charalampos Stratakis <cstratak@redhat.com> - 2.7.14-2Iryna Shcherbina <ishcherb@redhat.com> - 2.7.14-1Tomas Orsava <torsava@redhat.com> - 2.7.13-18Miro Hrončok <mhroncok@redhat.com> - 2.7.13-17David "Sanqui" Labský <dlabsky@redhat.com> - 2.7.13-16Michal Cyprian <mcyprian@redhat.com> - 2.7.13-15Fedora Release Engineering <releng@fedoraproject.org> - 2.7.13-14Fedora Release Engineering <releng@fedoraproject.org> - 2.7.13-13Charalampos Stratakis <cstratak@redhat.com> - 2.7.13-11Miro Hrončok <mhroncok@redhat.com> - 2.7.13-11Karsten Hopp <karsten@redhat.com> - 2.7.13-10Tomas Orsava <torsava@redhat.com> - 2.7.13-9Charalampos Stratakis <cstratak@redhat.com> - 2.7.13-8Karsten Hopp <karsten@redhat.com> - 2.7.13-7Karsten Hopp <karsten@redhat.com> - 2.7.13-6Karsten Hopp <karsten@redhat.com> - 2.7.13-5Michal Cyprian <mcyprian@redhat.com> - 2.7.13-5Charalampos Stratakis <cstratak@redhat.com> - 2.7.13-4Fedora Release Engineering <releng@fedoraproject.org> - 2.7.13-3Igor Gnatenko <ignatenko@redhat.com> - 2.7.13-2Charalampos Stratakis <cstratak@redhat.com> - 2.7.13-1Charalampos Stratakis <cstratak@redhat.com> - 2.7.12-9Charalampos Stratakis <cstratak@redhat.com> - 2.7.12-8Miro Hrončok <mhroncok@redhat.com> - 2.7.12-7Charalampos Stratakis <cstratak@redhat.com> - 2.7.12-6Charalampos Stratakis <cstratak@redhat.com> - 2.7.12-5Charalampos Stratakis <cstratak@redhat.com> - 2.7.12-4Charalampos Stratakis <cstratak@redhat.com> - 2.7.12-3Michal Toman <mtoman@fedoraproject.org> - 2.7.12-2Charalampos Stratakis <cstratak@redhat.com> - 2.7.12-1Charalampos Stratakis <cstratak@redhat.com> - 2.7.11-8Charalampos Stratakis <cstratak@redhat.com> - 2.7.11-7Tomas Orsava <torsava@redhat.com> - 2.7.11-6Charalampos Stratakis <cstratak@redhat.com> - 2.7.11-5Fedora Release Engineering <releng@fedoraproject.org> - 2.7.11-4Orion Poplawski <orion@cora.nwra.com> - 2.7.11-3Orion Poplawski <orion@cora.nwra.com> - 2.7.11-2Robert Kuska <rkuska@redhat.com> - 2.7.11-1Thomas Spura <tomspur@fedoraproject.org> - 2.7.10-11Robert Kuska <rkuska@redhat.com> - 2.7.10-10Robert Kuska <rkuska@redhat.com> - 2.7.10-9Orion Poplawski <orion@cora.nwra.com> - 2.7.10-�x��������������������X"
�?l((�������������h�$u����������������
�h�h�h
�odernized python2 macros.
- Inlined locale environment variables in the %check section.
- Remove bundled egg-info and .exes.- Update to 6.0.2- Update to 6.0.1. Fixes bug #1044444- Remove the python-setuptools-devel Virtual Provides as per this Fedora 21
  Change: http://fedoraproject.org/wiki/Changes/Remove_Python-setuptools-devel- And another bug in sdist- Fix a bug in the sdist command- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuild as wheel for Python 3.4- Rebuilt for tag f21-python- Add a switch to build setuptools as wheel- Update to new upstream release with a few things removed from the API:
  Changelog: https://pypi.python.org/pypi/setuptools#id139- Update to 1.4 that gives easy_install pypi credential handling- Minor upstream update to reign in overzealous warnings- Upstream update that pulls in our security patches- Update to newer upstream release that has our patch to the unittests
- Fix for http://bugs.python.org/issue17997#msg194950 which affects us since
  setuptools copies that code. Changed to use
  python-backports-ssl_match_hostname so that future issues can be fixed in
  that package.- Update to newer upstream release.  Some minor incompatibilities listed but
  they should affect few, if any consumers.- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Upstream update -- just fixes python-2.4 compat- Update to 0.9.5
  - package_index can handle hashes other than md5
  - Fix security vulnerability in SSL certificate validation
  - https://bugzilla.redhat.com/show_bug.cgi?id=963260- Update to upstream 0.8  release.  Codebase now runs on anything from
  python-2.4 to python-3.3 without having to be translated by 2to3.- Update to 0.7.7 upstream release- Update to the setuptools-0.7 branch that merges distribute and setuptools- Update to upstream 0.6.36.  Many bugfixes- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- rebuild for https://fedoraproject.org/wiki/Features/Python_3.3- remove rhel logic from with_python3 conditional- New upstream release:
  - python-3.3 fixes
  - honor umask when setuptools is used to install other modules- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Fix easy_install.py having a python3 shebang in the python2 package- Upstream bugfix- Upstream bugfix- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Upstream bugfix
- Compile the win32 launcher binary using mingw- Upstream bugfix release- Upstream bugfix release- Switch to patch that I got in to upstream- Fix build on python-3.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- rebuild with python3.2
  http://lists.fedoraproject.org/pipermail/devel/2010-August/141368.html- Update description to mention this is distribute- bump for building against python 2.7- update to new version
- all patches are upsteam- generalize path of easy_install-2.6 and -3.1 to -2.* and -3.*- Rebuilt for https://fedoraproject.org/wiki/Features/Python_2.7/MassRebuild- Upstream patch for compatibility problem with setuptools
- Minor spec cleanups
- Provide python-distribute for those who see an import distribute and need
  to get the proper package.- Fix race condition in unittests under the python-2.6.x on F-14.- Fix few more buildroot macros- Include data that's needed for running tests- Update to upstream 0.6.13
- Minor specfile formatting fixes- First build with python3 support enabled.- Really disable the python3 portion- Update the python3 portions but disable for now.
- Update to 0.6.10
- Remove %pre scriptlet as the file has a different name than the old
  package's directory- Fix install to make /usr/bin/easy_install the py2 version
- Don't need python3-tools since the library is now in the python3 package
- Few other changes to cleanup style- add python3 subpackage- New upstream bugfix release.- Test rebuild- Update to 0.6.8.
- Fix directory => file transition when updating from setuptools-0.6c9.- Fix duplicate inclusion of files.
- Only Obsol�x�������������p�������X#
th�	?b de��������������45t a �$$����������������
453555
�


























































































































	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������










	
























 
!
"
#
$
%
&
'
(
)
*
+
,
-
.
/
0
1
2
3
4
5
6
7
8
9
:
;
<
=
>
?
@
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d
e
f
g
h
i
j
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z
{
|
}
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������
	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��x���������������������X$
�?�A������@(�������~]�w��$\����������������
�~���U
� gnupg-2.0.1rc1- update %description
- drop dearmor patch- BR: libassuan-static >= 1.0.0- gnupg-2.0.0- upstream 64bit patch- fix (more) file conflicts with gnupg- 1.9.95- 1.9.94- 1.9.93- fix file conflicts with gnupg- 1.9.92- make check ||: (apparently checks return err even on success?)- --enable-selinux-support
- x86_64: --disable-optimization (to avoid gpg2 segfaults), for now- 1.9.91- respin- 1.9.90 (doesn't build, not released)- 1.9.23 (doesn't build, not released)- gpg-agent-startup.sh: fix case where valid .gpg-agent-info exists- fix "syntax error in gpg-agent-startup.sh" (#206887)- fc6 respin (for libksba-1.0)- fc6 respin- 1.9.22- fix "gpg-agent not restarted after kde session crash/killed (#196327)- 1.9.21
- omit gpg2 binary to address CVS-2006-3082 (#196190)- Don't hardcode pcsc-lite lib name (#184123)- fc4+: use /etc/kde/(env|shutdown) for scripts (#175744)- fc5: gcc/glibc respin- 1.9.20- include gpg-agent-(startup|shutdown) scripts (#136533)
- BR: libksba-devel >= 1.9.12 
- %check: be permissive about failures (for now)- BR: libksba-devel >= 1.9.13- back to BR: libksba-devel = 1.9.11- 1.9.19- configure: NEED_KSBA_VERSION=0.9.12 -> 0.9.11- re-enable 'make check', rebuild against (older) libksba-0.9.11- don't 'make check' by default (regular builds pass, but FC4/5+plague fails)- 1.9.18
- drop pth patch (--enable-gpg build fixed)
- update description (from README)- 1.9.17, signal info patch applied upstream (#162264).
- Patch to fix lvalue build error with gcc4 (upstream #485).
- Patch scdaemon and pcsc-wrapper to load the versioned (non-devel)
  pcsc-lite lib by default.- Include upstream's patch for signal.c.- Merge changes from Rex's 1.9.16-1 (Thu Apr 21):
-   opensc support unconditional
-   remove hard-coded .gz from %post/%postun
-   add %check section
-   add pth patch
- Put back patch modified from 1.9.15-4 to make tests verbose
  and change signal.c to describe received signals better.- Drop patch0 again.- Add patch0 temporarily to get some output from failing test.- Rebuild.- rebuilt- Make install-info in scriptlets less noisy.- 1.9.15- note patch/hack to build against older ( <1.0) libgpg-error-devel- 1.9.14
- enable opensc support
- BR: libassuan-devel >= 0.6.9- remove suid.- remove Provides: newpg- Requires: pinentry
- gpg2 suid
- update description- first try
- leave out opensc support (for now), enable --with-openscdirmngrgnupg


















































































































































































	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~���������������������������������������������������cacsdadeelen@boldquoten@quoteoesetfifrglhuiditjanbp�x�������������`��������X%
be�?- maP��������\�ed b�$N����������������
���
� for CVE-2014-4343, included in 1.12.2
  - drop patch for CVE-2014-4344, included in 1.12.2
  - drop patch for CVE-2014-4345, included in 1.12.2
- replace older proposed changes for ksu with backports of the changes
  after review and merging upstream (#1015559, #1026099, #1118347)- incorporate fix for MITKRB5-SA-2014-001 (CVE-2014-4345)- gssapi: pull in upstream fix for a possible NULL dereference
  in spnego (CVE-2014-4344)- gssapi: pull in proposed fix for a double free in initiators (David
  Woodhouse, CVE-2014-4343, #1117963)- fix license handling- pull in fix for denial of service by injection of malformed GSSAPI tokens
  (CVE-2014-4341, CVE-2014-4342, #1116181)- pull in changes from upstream which add processing of the contents of
  /etc/gss/mech.d/*.conf when loading GSS modules (#1102839)- pull in fix for building against tcl 8.6 (#1107061)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Backport fix for change password requests when using FAST (RT#7868)- spnego: pull in patch from master to restore preserving the OID of the
  mechanism the initiator requested when we have multiple OIDs for the same
  mechanism, so that we reply using the same mechanism OID and the initiator
  doesn't get confused (#1066000, RT#7858)- pull in patch from master to move the default directory which the KDC uses
  when computing the socket path for a local OTP daemon from the database
  directory (/var/kerberos/krb5kdc) to the newly-added run directory
  (/run/krb5kdc), in line with what we're expecting in 1.13 (RT#7859, more
  of #1040056 as #1063905)
- add a tmpfiles.d configuration file to have /run/krb5kdc created at
  boot-time
- own /var/run/krb5kdc- refresh nss_wrapper and add socket_wrapper to the %check environment- add currently-proposed changes to teach ksu about credential cache
  collections and the default_ccache_name setting (#1015559,#1026099)- pull in multiple changes to allow replay caches to be added to a GSS
  credential store as "rcache"-type credentials (RT#7818/#7819/#7836,- update to 1.12.1
  - drop patch for RT#7794, included now
  - drop patch for RT#7797, included now
  - drop patch for RT#7803, included now
  - drop patch for RT#7805, included now
  - drop patch for RT#7807, included now
  - drop patch for RT#7045, included now
  - drop patches for RT#7813 and RT#7815, included now
  - add patch to always retrieve the KDC time offsets from keyring caches,
    so that we don't mistakenly interpret creds as expired before their
    time when our clock is ahead of the KDC's (RT#7820, #1030607)- update the PIC patch for iaesx86.s to not use ELF relocations to the version
  that landed upstream (RT#7815, #1045699)- pass -Wl,--warn-shared-textrel to the compiler when we're creating shared
  libraries- amend the PIC patch for iaesx86.s to also save/restore ebx in the
  functions where we modify it, because the ELF spec says we need to- grab a more-commented version of the most recent patch from upstream
  master
- make a guess at making the 32-bit AES-NI implementation sufficiently
  position-independent to not require execmod permissions for libk5crypto
  (more of #1045699)- add patch from Dhiru Kholia for the AES-NI implementations to allow
  libk5crypto to be properly marked as not needing an executable stack
  on arches where they're used (#1045699, and so many others)- revert that last change for a bit while sorting out execstack when we
  use AES-NI (#1045699)- add yasm as a build requirement for AES-NI support, on arches that have
  yasm and AES-NI- pull in fix from master to make reporting of errors encountered by
  the SPNEGO mechanism work better (RT#7045, part of #1043962)- update a test wrapper to properly handle things that the new libkrad does,
  and add python-pyrad as a build requirement so that we can run its tests- revise previous patch to initialize one more element- backport fixes to krb5_copy_context (RT#7807, #1044735/#1044739)- pull in fix from master to return a NULL pointer rather than allocating
  zero bytes of mem�x�������������آ�������X&
4?6��
XQ�������V<�$+����������������
�V�V
�D�<?�d
�
�
�
�	
�	F
��
��
�

�

�
!
�
'
�
+
�	
I
�
U
�
�
�
�

�
oX
o	
6
o


o�
oi?
o
j�
op�
ow�
o~�
~�
o��
�����?(�[
8�d>9�\>:�>G��
oH�l
oI�(
oX��
Y��
\�
o]��
o^�Fb�L
d�x
e�}
fǀ
lǂ
tǜ
ou�X
ov���p
��t
��z
�Լ


��

��6
�

�6

�P

�y
�ټ

�
o�0
g�4
h�8
Cxkeyboard-config2.281.el8X Keyboard Extension configuration dataThis package contains configuration data used by the X Keyboard Extension (XKB),
which allows selection of keyboard layouts when using a graphical interface.`t
ord1-prod-a64build001.svc.aws.rockylinux.orgV�KojiRockyMITinfrastructure@rockylinux.orgUnspecifiedhttp://www.freedesktop.org/wiki/Software/XKeyboardConfiglinuxnoarch�a
��l�
�
�
�t
��m
T�2�
�T��OP�*p
�eQC�d��_1?8���p�;�(�:�a ZMo&/gR�
�
��
I/��D"��kJ
r�	c
��!��[�������������f
0[Y
�(l���R4����1�F�A�	���T� c����Y^{
W�	7V	�*3e�(>�u_O�
��'#�2��	58.��	�NZ4O5?�
r��Z�0�97E�_!}\���
F�@�7�9-�� BJE0����
�
J�-R
��y�F
%|R��

O�#�
@O6�~�.;=
�m
��
�	U
(�P�c�2+�<
��B�*��9�g��L	u���J�����>
��A�
iIC�g����J�t������(�(�3B�>���
e>�
Hy�;@=�_����=
� �
.�

�$]�6[[]�Z�n
��
C�-�
U�
8�
U��-�
7q
B�
L�
Ig
6'
>�
L�
5�
)��c�u�
Z�+b��

G�
K
C�
8f��
���J���c_
>
H�
���s����,AA�A큤����������������������������������A큤��������A큤������������������������������A큤������������������A큤������A큤������������������A큤������������A큤����������������������������A큤������������������������������������������������������A큤������������������������������A큤��������������A큤����������������������A큤����������������������������������A큤����������������������������������������������������A큤������A큤������������������������������A큤A큤����������������A큤��A큤��������������������������������������������������������������������������������������������A큤����A큤������������������������A큤�����������������������������������������������������������������������������������������������������������x�������������P��������X'
 k�?b ha0A�������������_ fix�$����������������
�_�_�_
�edhat.com> - 12:4.2.3-8.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-7Adam Tkac <atkac redhat com> - 12:4.2.3-6Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 12:4.2.3-4Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-3Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-0.1.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-12Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-11Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-10Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-9Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-8Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-7Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-6Adam Tkac <atkac redhat com> - 12:4.2.2-5Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-4Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-3Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-0.4.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-0.3.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-0.2.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.2-0.1.b1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-12.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-11.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-10.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-9.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-8.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-7.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-6.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-5.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-4.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-3Rex Dieter <rdieter@fedoraproject.org> - 12:4.2.1-2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-0.6.rc1Adam Tkac <atkac redhat com> - 12:4.2.1-0.5.b1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 12:4.2.1-0.4.b1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-0.3.b1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-0.2.b1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.1-0.1.b1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-26.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-25.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-24.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-23.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-22.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-21.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-20.P1Dan Horák <dan[at]danny.cz> - 12:4.2.0-19.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-18.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-17.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-16.P1Adam Tkac <atkac redhat com> - 12:4.2.0-15Adam Tkac <atkac redhat com> - 12:4.2.0-14Adam Tkac <atkac redhat com> - 12:4.2.0-13Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-12Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-11Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-10Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-9Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-8Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-7Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-6Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-5Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-4Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-3Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.0-1Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-26.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-25.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-24.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-23.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-22Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-21Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-20Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-19Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-18Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-17Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-16Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-15Jiri Popelka <jpopelka�x����������������������X(
 t�?ySQL(l�d�Uing �$����������������
�U�U�U
�bfc85374fa675ccf1e75f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=dd7c3074365202761fc979decc79ecb87ed84915, strippedPOSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=8f94b0f99bef2d19dce8ea978f076c5faf8d8a3a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c2647bae4e9a6ec728ed365ccf8d41ec95f6975e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c48f7d6ae3c260e1f2e17e0c899956c09a5e53f5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=126a46b12be6d5c43e2679908a2a18fabc0a7a4d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=1e7967ef5d441bf2298b827b2c02938715e9bce2, strippedASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=077f681871652147bab2a229280dc1d582e604d7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6fcb7c056d333116ab69654696f22e0f06982634, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d2d5f360240cba3640cf2e753e5305879afba427, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=58bcef962067cfbedfeff0e7512e4914e83323c2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b05f795d42829190efc7bcefe9018796bffa706f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=bfff98c7d37f4fcffb2c915f9c44a43fd7140839, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c2eddf1ba636dd04fd934e1060d674b1d6729ba6, strippedUTF-8 Unicode textGNU message catalog (little endian), revision 0.0, 2205 messages, Project-Id-Version: GNU gnupg 2.2.20 'Enter the user ID.  End with an empty line: 'troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)/DYp�����������

 
:
;
<

�x�������������0q�������X)
7a�?ea87������@(�������2c8e�$r����������������
���
� Backport fix of memory use after free during libkrad cleanup
- Backport support for larger RADIUS attributes in libkrad
- Resolves: rhbz#2103125- Try harder to avoid password change replay errors
- Resolves: #2077563- Fix kprop for propagating dump files larger than 4GB
- Resolves: #2026462- Backport usage of SHA-256 instead of SHA-1 for PKINIT CMS digest
- Resolves: #2066316- Fix KDC null deref on TGS inner body null server (CVE-2021-37750)
- Resolves: #1997601- Fix KDC null deref on bad encrypted challenge (CVE-2021-36222)
- Resolves: #1983729- Backport KCM performance enablements
- Resolves: #1956388- Add APIs for marshalling credentials
- Resolves: #1964619- Update tmpfiles dropin to use /run instead of /var/run
- Resolves: #1945679- Add support for start_realm cache config
- Resolves: #1901195- Add recursion limit for ASN.1 indefinite lengths (CVE-2020-28196)
- Resolves: #1906492- Document -k option in kvno(1) synopsis
- Resolves: #1869055- Enable MD5 override for FIPS RADIUS
- Resolves: #1872689- Unify kvno option documentation
- Resolves: #1869055- Fix upstream URLs in spec file
- Resolves: #1868039- Fix leak in KERB_AP_OPTIONS_CBT server support
- Resolves: #1860831- Ignore bad enctypes in krb5_string_to_keysalts()
- Resolves: #1858322- Match Heimdal behavior for channel bindings
- Code hygiene + test stability fix included
- Resolves: #1840518- Drop DES3 from sample kdc.conf
- Resolves: #1802334- New upstream release (1.18.2)
- Resolves: #1802334- Omit KDC indicator check for S4U2Self requests
- Resolves: #1802334- Pass gss_localname() through SPNEGO
- Resolves: #1802334- New upstream version (1.18.1)
- Resolves: #1802334- New upstream version (1.18)
- Resolves: #1802334
- Resolves: #1820311
- Resolves: #1791062
- Resolves: #1784655- Put KDB authdata first
- Resolves: #1800575- OpenSSL has an epoch, apparently
- Resolves: #1754690- Put openssl runtime requirement in the right place this time
- Resolves: #1754690- Restore accidentally dropped patch
- Resolves: #1754690- Fix krb5kdf support and add proper openssl version requirements
- Resolves: #1754690- Full FIPS compliance
- Resolves: #1754690- Backport soft-pkcs11 testing code
- Resolves: #1734158- Fix KCM client time offset propagation
- Resolves: #1738553- Fix source URLs in spec file
- Resolves: #1755959- Fix argument order on strlcpy() in enctype_name()
- Resolves: #1754369- Clean up etype display on KDC
- Resolves: #1664157- Fix pkinit_anchors path
- Resolves: #1661339- Re-provide krb5-kdb-version in -devel as well (IPA wants it)
- Resolves: #1645594- Move kdbversion info into -server for IPA (so we can rebase)
- Resolves: #1645594- FIPS: disable 3DES and ed25519
- Resolves: #1616326- Use openssl's PRNG in FIPS mode
- Resolves: #1663571- Address some optimized-out memset() calls
- Resolves: #1663503- New upstream version (1.17)
- Resolves: #1645594- Remove incorrect KDC assertion
- Resolves: #1673016- Fix RC4 blocking in FIPS mode
- Resolves: #1660222- Gain FIPS awareness
- Resolves: #1660222- In FIPS mode, add plaintext fallback for RC4 usages and taint- Fix k5test prompts for Python 3- Remove outdated note in krb5kdc man page- Make krb5kdc -p affect TCP ports- Eliminate preprocessor-disabled dead code- Fix some broken tests for Python 3- Zap copy of secret in RC4 string-to-key- Convert Python tests to Python 3- Add build dependency on gcc- Use SHA-256 instead of MD5 for audit ticket IDs- Add BuildRequires on python2 so we can run tests at build-time- Explicitly look for python2 in configure.in- Add flag to disable encrypted timestamp on client- Switch to python3-sphinx for docs
- Resolves: #1590928- Make docs build python3-compatible
- Resolves: #1590928- Update includedir processing to match upstream- Log when non-root ksu authorization fails
- Resolves: #1575771- Remove "-nodes" option from make-certs scripts- New upstream release - 1.16.1- Fix configuration of default ccache name to match file indentation- Set error message on KCM get_princ failure- Set error�x��������������`�������X*
�?B`���������c�\��$s����������������
c�b�
�K
Z?
T�d
�
�
�
�	B
�	}
��
��
�
$
�
(
�
-
�
3
�
:
�	
X
�
n
�
�
�
�

�oPo	.o
o�o!wo
"8o#�o&o(J
(�o*H*�*�,',�
,�
,�
(,�
8,�
�94�
�:�
�G
>�oH
@�oI
B@oX
B�Y
B�\
C4o]
D�o^
Jb
J�
d
K�
e
K�
f
K�
l
K�
t
Lou
M�ov
O�	w
P�ox
R<oy
S�
�
T 
�
T$
�
T*
�
Tl
�
Tp



T�


T�6

V�

V�6


Y,


YU
�
Y�


Y�o
Z
g
Z
h
Z
Cpython2-devel2.7.1817.module+el8.10.0+1813+4b021305.rocky.0.2Libraries and header files needed for Python 2 developmentThis package contains libraries and header files used to build applications
with and native libraries for Python 2fO$�ord1-prod-x86build001.svc.aws.rockylinux.orgKojiRockyPythoninfrastructure@rockylinux.orgDevelopment/Librarieshttps://www.python.org/linuxx86_646Ry��K����
������r7)= y	��
R�w-N���{}��


	C���
�a��{8�#�����
����*-�E!
\�!��h.
�.B��:�+U^�a����{
��

F\
p)����2�!���큤�����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������큤A큤����fOffOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOffOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOefOSfOefOffOffOefOefOefOefOefOefOffOefOefO$�^��^��^��aa83cfe3232e40c8f1d0e673cb67741bf0de1fbcb18c4bad77e0bc61cf11ff02079a16d5352e49c31cf6bb7a84b5a9204ff4b4028b6d359728d20bc4118d85e4832bc95ff40f396e7eacad29214ba29b6ae16052d998d26ad93a310efd08b11dd9d4d5516cf2afc0cc662d81dfc86a1000f57965e7283f53c9aed526471f269caa0552827e26ef59252085411b8c651e70cf6262ecb0501eb6561fc7fd00d04bf75dba02c80c2d26b3f10fee55df921de8f5ca0c62257b834c325fa840136150afbbf716c0d6d777ae4c4e30121b1cdb00c5f09f478bd815d45d87654ed232e8efdceb3795bbce2c3ececf01a8346146979b9d5fa19179bbe789bb7c2c85bed4c6acae380c0dd9ec59b149e5fb70bb6d83c133de3f3c33054d81196fc2bb618c46e6fb15817a52fc88555fda2de52df3b6d8a9f80da5d06e90d25fba8f5d8397d058fcf2994c3953589e112ba79524721ffe877b5e25bebee5367b04d071e64e7c53b55d0de55d67b42c5da4e12d6acf25196d8f480ff02c218c0764a3bdbb224f7c321a8603dcfcc36d68f2eb2d55b41d4ccec1097af5cf7c8a9bbe44f2c489c61c2545764d5aedbe18fe7dd84433ed0a3d9fa175a0cd7ebbe50b8a3026a9f8f66d6ff51633d8c3f9856cdb89c19419e61c5af975bd266748f0f90ffb6d66198accbe40cc6fba72954e610e9d328e2130ff9a312557f02bd02f58cfe89e9f19a7970e9a70902fb114af72e3da488a20ba4706ab0c03def86b41e4cba98023fb096750b39f403fe4db88�x������������� P�������X+
M?R;hj������ʞ�$Z����������������
ʞɞ
�enable-assembler switch is now automatically disables on
  platforms there assembler code is unavailable. This should allow
  building this RPM on non i386 systems.- Removed unportable cc switches from the spec file. The defaults can
  now be overridden with environment variables. This feature is used
  to compile the official RPM with optimal (but compiler version
  specific) switches.

- Removed the repetitive description parts for the sub rpms. Maybe add
  again if RPM gets a multiline macro capability.

- Added support for a pt_BR translation. Translation contributed by
  Jorge Godoy <jorge@bestway.com.br>.- A lot of changes in all the rpm and install scripts. This may even
  be a working RPM :-)- A developers changelog for MySQL is available in the source RPM. And
  there is a history of major user visible changed in the Reference
  Manual.  Only RPM specific changes will be documented here./sbin/ldconfig/sbin/ldconfigminimal-centos-6-x32-2258 1606088872










	
���5.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el8
mysql-x86_64.confcoredumper.h.build-idf2829527c5a6d0d152e4494e10615924c2129dlibcoredumper.amysqllibmysqlclient.so.20libmysqlclient.so.20.3.19Percona-Server-shared-57README/etc/ld.so.conf.d//usr/include/coredumper//usr/lib//usr/lib/.build-id/aa//usr/lib64//usr/lib64/mysql//usr/share/doc//usr/share/doc/Percona-Server-shared-57/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu
ASCII textC source, ASCII textdirectorycurrent ar archiveELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=aaf2829527c5a6d0d152e4494e10615924c2129d, strippedPPPPRRRRRRRR
RRRRRRRRRR	RRRR
RRutf-848017183453f06f12cd6873e2e1555a22433d48df466a4a4f2d510cd735b2b08?��� ���
_���
	�4�_��x��ea��7���p��h��1:]p�!���.��cl��)o�@Z��h����:�P+O��"B<�_�ė,BV����Dm�B�qr��Zs:�V��s*���05^��C�U���l�,�m�ot�	 �+�5��f
_j��I�T�(�©�@*�l_	UխmmNlQYdpKd,�5P����qn��	M���F�E�~{�y����'�\�����;p���Y����
$V.��Գd55áTT�����΍�<�jTuYY�O���Jy��[S��I�BI�T����1K1ћ�u����.�PeQ�H�7J�9�SMî
�{��M�qH�[ȗ-���hHL��x��[B�-��z���~䒩̟���Y�A&�|��z���)�l�<]e
O�1��Y����,Z��0�X��<=(WCF���I",u��ffR�*C���
���Z`������`������yFm�s��َ��Z>�c����6�.L~�%���r�@q:�,?��
_���
	�4�_��œ�Q�Y|��j�x~�t�w���V�#�W�Y�5�zo�t�%�����H�o#e1]�\S�9�D�7	�`��8��ѐNx������e$��;�y�RW�pT�4d���(�<�z�"1�20�A8��0�V�fԗQO�T�t���\S��f���r�f�Dg�O��G�q;6����YDj���
��0�g�;'��Z�Z8h��7 �7���pyZ����v
;���[C�7����R���w��m���Ufrt�^o�T~�,��xET0鞭�?z4���?IP�'~���ң���?Lgݣݚq�&�.v�Ċ�R�!o�_�y�%_B�|'�+�G�������$A'�&A�l.�1+��ی�U��8�ģ��ć'Y|��"�- �/�.�2
X�2+Ϗ���6�dn���{TܷҽӢc�y�B'K[顴�#[;��咋عW�R�:s��[W�I��ƅ֕�mh�@Y+|��Q&�N\{
?��_lH�B�DF�`ê5�0�"v-�u�Bb��c8cedeb79595171f5e2e5bda5b0a88b23dc7f6ce175aad46f804980a2ae24bb11e04c37b67b717b25495a7e0102aea5a803ea35bg�A<�Lg�@ruehe@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent.boortz@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.co�x��������������?�������X,
te�?ta.0c0m�9og d�$E����������������
�9�9
�R	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RRRRR	RRR
RR
RPRRRRRRRR
RR
Rhttps://forum.remirepo.net/utf-8792dce6365f17a8edd5e98c8ca00c6f6162d55b25f67bb7a1cab05e114d6ec3e?���@s���]��h���kUަ���F
0!k8��#��+���UP�Y_sZaw˟remi@remirepo.net
	UP�Y_sZ���Z"�����]�+������-�
�y�)�Q�
3ߪ���'�	ҟ���jkU�(
{�i0_΁�:1��r��+\���(I��1MH�
f(�d�X� CVqL�
�sE��%.�o�姺��c����.��*�9u���>G�I����|A�Q�bb"�P�t;
�U1�
�	���'�G�ƶ ���4?�i'!���۪�)�(*P�o�+���Fm�4R!�#�f���1Y��ا�u����n�o�E
%?����k��R����Ȏ���<�"V��-֤+��N�S�6�e�
�{#:;D��U5F^��4v��knP��fU���
�$m�SX�ǝ�Z�jS�1X!u<I1aҩ]P�H2d~���N�.R�N<��9�>pc�f��;�k�7��Zf*�T?Q��*�c$_���y��C;�OFx�R���(��Ը���w�&&e�z�!*�� \��Bd�VVx�c�;R?��)�+%\�X����	�yF�����
07e2a0a0e0c11ea9fb17478dc2826f69fb9b06f8169a2020a2c730517cdc3efd3f8a647fcde80b17ff6ca6ab20ded0d8d0bff3feg?
W�g1eanup (Kamal Heib) [2056498]
- RDMA/nldev: Check stat attribute before accessing it (Kamal Heib) [2056498]
- IB/hfi1: Properly allocate rdma counter desc memory (Kamal Heib) [2056498 2049845]
- RDMA/core: Set send and receive CQ before forwarding to the driver (Kamal Heib) [2056498]
- RDMA/netlink: Add __maybe_unused to static inline in C file (Kamal Heib) [2056498]
- RDMA/core: Require the driver to set the IOVA correctly during rereg_mr (Kamal Heib) [2056498]
- RDMA/irdma: optimize rx path by removing unnecessary copy (Kamal Heib) [2056498 2037972]
- IB/opa_vnic: Rebranding of OPA VNIC driver to Cornelis Networks (Kamal Heib) [2056498]
- IB/hfi1: Rebranding of hfi1 driver to Cornelis Networks (Kamal Heib) [2056498 2049845]
- RDMA/rxe: Make rxe_type_info static const (Kamal Heib) [2056498]
- RDMA/rxe: Use 'bitmap_zalloc()' when applicable (Kamal Heib) [2056498]
- RDMA/rxe: Save a few bytes from struct rxe_pool (Kamal Heib) [2056498]
- RDMA/irdma: Remove the unused variable local_qp (Kamal Heib) [2056498 2037972]
- RDMA/core: Fix missed initialization of rdma_hw_stats::lock (Kamal Heib) [2056498]
- RDMA/irdma: Remove the unused spin lock in struct irdma_qp_uk (Kamal Heib) [2056498 2037972]
- RDMA: Constify netdev->dev_addr accesses (Kamal Heib) [2056498]
- RDMA/ipoib: Use dev_addr_mod() (Kamal Heib) [2056498]
- RDMA/core: Use kvzalloc when allocating the struct ib_port (Kamal Heib) [2056498]
- RDMA/irdma: Make irdma_uk_cq_init() return a void (Kamal Heib) [2056498 2037972]
- RDMA/rxe: Convert kernel UD post send to use ah_num (Kamal Heib) [2056498]
- RDMA/rxe: Lookup kernel AH from ah index in UD WQEs (Kamal Heib) [2056498]
- RDMA/rxe: Replace ah->pd by ah->ibah.pd (Kamal Heib) [2056498]
- RDMA/rxe: Create AH index and return to user space (Kamal Heib) [2056498]
- RDMA/rxe: Change AH objects to indexed (Kamal Heib) [2056498]
- RDMA/rxe: Move AV from rxe_send_wqe to rxe_send_wr (Kamal Heib) [2056498]
- RDMA/irdma: Remove irdma_cqp_up_map_cmd() (Kamal Heib) [2056498 2037972]
- RDMA/irdma: Remove irdma_get_hw_addr() (Kamal Heib) [2056498 2037972]
- RDMA/irdma: Remove irdma_sc_send_lsmm_nostag() (Kamal Heib) [2056498 2037972]
- RDMA/irdma: Remove irdma_uk_mw_bind() (Kamal Heib) [2056498 2037972]
- RDMA: Remove redundant 'flush_workqueue()' calls (Kamal Heib) [2056498]
- RDMA/iwpm: Remove redundant initialization of pointer err_str (Kamal Heib) [2056498]
- RDMA/nldev: �x�������������/�������X-
�?�+�U�$����������������
�U�U

RR%RRRRRR
RR
RRR	RRRR!R"R$RRRRRRR RRRR,RRR
RRRRR	R
RRRRRRRR,RR!RRR
RRRRR	R
RRRRRRRR RR,RRRRRRR
RR
R	RR(RR&RRRR#RRR,RRR!RR
RRRRRRR	R
RRRRRRRR RR,RRR
RRRRR	R
RRRRRRR#RR,RR
RRRRR	R
RRRRRRR,RRR
RRRRR	R
RRRRRRR,RRR
R	RR,RR
RRRR	R
RRRRRR(RRR,RR
RRRRR	R
RRR(RRRRRR,RRRR
R	RR,RRRRR
RR
RR	RRRRRRR,RR
RRRR	R
RRRRRRR,RRR
RRRR	R
RRRRRRRR,RRR
RRRRRR	R
RRRRRRRR,RRR
RRRRR	R
RRRRRRRR,RRRRR!RR
RRRRRR	R
RRRRRRRRR R'RR,RRRRR
RRRRR	R
RRRRRRRR,https://bugs.rockylinux.orggnupg2-smimepinentryutf-8d237abd06652a86f109899d979bf2f5400c1e9dd7f1138e31b7cfa71bcacc17f?����&\,	�	M���_1��@+��3
!pQ�p�)�Tξ7��]�mtZ`ij�;
	�]�mtZ`Qf���oKqa�hن]�Jm��Ѱ̓`L�l�MP����/PjٶW7x��#�nY\�e~�����f���H�,J�O�	g�#}�3/���D4�'�%��I|<�7'1����rK�
�HR2���ȷ�����%�7
��o$?؆���U���o[1=�7�uB1t�1�d�"��}�d?�ŧ'��`s��PB�F&J�~/W�#�FCa��G�v��>���<X����6�]1�!�mV1t`Va4��ׯ�r
�L2
V�1����r��H�]�
[i�U{|�_Q=;]Bb��^�kD��B#��:&�)O���r��K�5’Y�>���}��-<�Uʝ���Ó�(V�F�Km�����
��^_�.�˾�(�y���Mlm��{��̮|�O-�`.~��͗<�O9�~��v�]��=��}/�>@�]�/7���T����a�Q��o_��s�
����A�F��]9 j	�#���8�ao�%��h��>�k\o�42bfdb6ff09fa82adcbf0e7077a61c482f45c93cee9630a032902fec3e0711548209c8b50db3b9c45c8453e290f7c9b3438f57d2iy��Liy�ASoC: rt5665: remove redundant assignment to variable idx (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: rt5514-spi: don't use snd_soc_lookup_component() (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: rt1308: simplify the EFUSE read function (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: rt1308: Remove executable attribute from source files (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: rt1308: Fix platform_no_drv_owner.cocci warnings (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: rt1308: add silence detection and manual PDB control (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: rt1308: Convert headers to SPDX (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: rt1011: fix DC calibration offset not applying (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: Relocate my e-mail to .com domain zone (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: nau8825: fix fake interruption when booting (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: nau8822: support master mode (Jaroslav Kysela) [1738610]
- [sound] ALSA: soc: codecs: mt6358: change return type of mt6358_codec_init_reg (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: msm8916-wcd-digital: Add sidetone support (Jaroslav Kysela) [1738610]
- [sound] ALSA: ASoC: max98383�x���������������������X.
 C�?n McU
�9������Ξause�$^����������������
Ξ͞Ϟ
�(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-1Percona-Server-shared-55Percona-Server-shared-564.14.2Y���W�@W��V�@V�w�V��@Vii@V
}@U��@U\w@Tи@T�@T�@S�S��S�.�S�@S���SX��SB�@S9X�S L@Sc@R��R�
@Rj]@Rj]@R^�REs@R6�R' �R��R��R@Rq@Q���Q�M�Q�Y@Q�Q�@Qֵ@Q��Q��Q��P��@Puc@Pn�P�@P@O��ON@N�@Np�@NoE�NoE�Nh�@N\�N\�NNP@NE�N-Z�N(�N��MR��MF�@L�LΫ�L�d�Lb��Lk@L�@K�@K���K�[�K��@K���K��@KuB�KK�K2@K
>�J�1@J��@J��J�u@J���J��@J�:�I-�I�@I�@H��H��@G��@G�@G�s@F8}@F��F
@E�{@E��E�=�E���E�<�En�E\R�EX^@D��Do�Da�DU�@DR�D<�D;�@D.k@D
u�D$@C��@C�t�C�.�C��@C�O@C�f@C�+�C�@C`�@CV5@CV5@CP�@B�@B�`@Bץ@B��B�:�B��@B�h�B�E@BfD@B]	�BQ,@A�@A�b�Aڅ@A�?@A-�A%�A��Ag@A�@�@@��@@qJ@@+j�@�@@�?��?�@?�\@?�s@?��@?O@@?/�@?�>��>���>l~@>H�>5@=2�@<�{�;��@:��@:Q�9�%@7�7�O�7{X@6�F�6@A�5��Evgeniy Patlan <evgeniy.patlan@percona.com>Evgeniy Patlan <evgeniy.patlan@percona.com> Evgeniy Patlan <evgeniy.patlan@percona.com>Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.11-4Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-3Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-2rc2Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-1rc1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.9-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Bjorn Munch <bjorn.munch@oracle.com> - 5.7.6-0.1.m16Erlend Dahl <erlend.dahl@oracle.com> - 5.7.5-0.6.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.5.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.4.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.3.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.2.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.1.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.5.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.4.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.3.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.2.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.1.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.3-0.3.m13Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.3-0.1.m13Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.15-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-2Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-5Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-4Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-2 Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-9Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-8Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-7Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-6Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-5Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-4Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-2Balas�x��������������������X/
�	?�ȶ�������5
�$����������������
555
�e23bcacb3081c4ca3a6ddd68b7974d6eafe41512d938b646f1271914181ffc835e4940a002c817cb823dff5c6fa2039a26103ad7a833347102b38bc87c1d10489f31ba4c9d8a7f101bc047a9846c3d8e0e2fa7266f8e026ea5e5d53d31c52f7b5611e499b6d58df002d41cfa38ba55e6fa93f33983a034672148e1e81c853767c21fa9434aa3c56a2e2a09e279d75c6996e0a75ab3117dd04147919687797d5f4f4f02fe85d6d736adc29a0999a07d5c2c13a39b21efcfbb1db799455803ed83f70085799c02c732a7cd2f4eddf10064e2a67a6073cdd5fbfc02bf274d10b5572eaec92e4c565a73e4b8ab4f888b42af3a398ce35da605d03e10935769ac423b4e1493e6dd67762052968e10123930fe3e0c45e241aac25b7574af1c35911cfe4da535468fbc29d0562f47764df92a5a30c3f0f989b8d4a6ac60a9c24ff0ef55b8c65e9aeb97ead8d70f136322989dd53266513d7df910c80e3e8c8f71ff9f735e49f9b8bc5c04347850a8836e85c3dc95d186f5ca002a298075c3d0b3f67d1f8fc8195b437f05589c908e0b404d56922da72f0218b3fd063931147765d264d2d09edf76a7a597c51884fa1dc223dad77d347b44f005a0e86780221c293fc18fbd91341a3e41154c1a210dad3271c377c0840eeec69744770e8ce354e31d8b52551adc8a04901be38f603a36d568ef9fd0fac2fbaaa1f46cc16e634a4ae1df2de3448a81df32c7dcf4b41b8cd95ffc47589bbf468316fadcd77d58e7e86525b71f8c26ae46a18539f3a4abc5444cbc39ff8c13092278adbe2260e0ee7e88e53ee88d166c00dbd44f5bf2a4a2b2363c87e49bd7160b2b697156e4fb0b9bc1413c61399b467ebcd818b32880c7c25f6586c3e994b39243dfa64d0035023f6290811343f1a03b1d49b995293b9f5ffbab2a722384245c4ad781be625c394a3d7a3caffd479c83adf9b152077403d483295fbb52e49303760b9956afe49f3a1bd1729bed851732d9ce9746e6245f75c917f9488d8e6740bd97ca00472c9afa597c13b237e77ce86f73d83157af38d92178e314a7fe230e87eb118dc722ee431caefc712b2921d4165304c826bd74fc1d2e1eac59e87de4378acad57caec3b2292844c3dcba802169eb141a5fbd8adeaebc6e9fb053ceafdca716919a4cc938b795d35fb67f4e3fe3ca8ccc2c01fc5e6320ae410bfb9aeee88031589f990594f4d75a194a150630b0b7ee0f33c98452ee1a8b59ebd8b46f1255192c1e1ae2071b64b166f66d3500aafce96e2d156d9a3751beac904799030fa8a08651fb35ff5a909bc720a85a4d307ac22f1d63489ceed6dd72703570857436dd7238438f3772f7b0693503b3e1fe14e16df4c6d38d06a49473d73d01ca23648f9787805fec84209b3670b0d32d93e06a8e7a77c2568e7477cd4b1abceaf802c0d737f9d7fa52a8085ef3231878fe762660df6471f7933e9f708e41e121e4e9159c280a9d54566e216c1abdd5b5ccb5b7d8f7ae622095d48fdd86a964fe7ef807f1854e3342e71771b3ed44965a90403b084272a7bd321e85f440b13c4c0c0ceefc45f4f60fb630714f71752c637015f410fe74a6468c742b2caec057a19828da14ed63195c1f5088c80dd3ea49b40694c4eb0c3e7cad2350378ee009917603afc92b7529ec838620dce0448511184d0aac0f3b41e9021b74863dab6548f4f9ef57594c38cd6be6575f7a437b12c1a49877ddc821f085538b4e3204a8e9bd8b0adfe0052690523f24b4914e0d5f738c093fc1d8b75c9c9c95de130e690a97812f60aac71ea0f456f40180d64fa01cd298bda783d243a4e4cef878eaec4a020a52d0ba8ba19f6e6ba01b0784a9d854ab09b5787a8095ef767d625b2ae1c6f930a50acaf9e2a8311cee8b090a91f17a5329342a3e758af67e2243c0cde1861466c5462d079b579b51a90004f8690736f31176deacfd7c2aabff6a266afda2edf060c38c50cc4f3dcc0dc53f0c7096117de979d20cf6ceb4b2e7f8cd93ed9bf26f5609efa203062bf3a2046e45fbc008a3bc2e5ceefd95b28d5d45c67d4c0384c653ad0de4ddc64ab0057406364045187277c90731bd98b37e8f742cb674e13fd9e574825ef168b6ba7b52cd2c7bc86b88efab8c7f29238b74421e7689275f669760742e8cb0c5578f85db50e7ae4b5f4b89c2435052d612130dda1a61aef5663cc068a977cd6627c946d1dd0cef9befcb5789b6e5d2ab600b3bfdb5cf6fea8cf070d5fdd79953f537f86bd95dbd64dc2afde6f0b1c464460e58eb5b7c0c76965d2f73617f4bb59fe936a9db026de2fa17c4d8ae68dc204a1b6b58b7a7a12569367cfeb8a3a4e1f377c73e83e9e80e15dd331d8971e24aeb2c49fdf367ac3ad9b3ddd8e21b40454838608e5bdc299665a5a6bd9921c1f044013f4ed58ea74537cace14fb1478504d302e8dba9400ffccae46cb3a15b117acd0790b2738a5b45417d1b2822ceac57bdff10ef3bff901c476dd7ad0693deef1ae56fe7bdf748a8b7ae20fde1922dddf6941eff8773df0a164bad8aac6a282b2ab3e334129e315b2696ba57b834d9d68089b4f0725f1992d17873fa151467e3786f48ea060b161a984acacf2a7a460390c55782de482929b0244ae3ca9ca3d1b459982e45e5e33b73c61080b6088d95e29ed64db2d801ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b5cae73aa3506d9ae3ecba78b1d9f13858729e96594add96610bc4dca971cd921558a7fe9ccb2922e6c1e05c34999d75b8ab5a1e94773772ef40c904d7eeeba0fe34cebeb0202670927c72b8b1�x�������������x��������X0
-c<?m64 0��<�	nchr�$H����������������
�	�	�	
�s.pyosyntax.pysyntax.pycsyntax.pyotransformer.pytransformer.pyctransformer.pyovisitor.pyvisitor.pycvisitor.pyoconfigMakefilecontextlib.pycontextlib.pyccontextlib.pyocookielib.pycookielib.pyccookielib.pyocopy.pycopy.pyccopy.pyocopy_reg.pycopy_reg.pyccopy_reg.pyocrypt.pycrypt.pyccrypt.pyocsv.pycsv.pyccsv.pyoctypes__init__.py__init__.pyc__init__.pyo_endian.py_endian.pyc_endian.pyomacholibREADME.ctypes__init__.py__init__.pyc__init__.pyodyld.pydyld.pycdyld.pyodylib.pydylib.pycdylib.pyofetch_macholibframework.pyframework.pycframework.pyoutil.pyutil.py.binutils-no-deputil.pycutil.pyowintypes.pywintypes.pycwintypes.pyocurses__init__.py__init__.pyc__init__.pyoascii.pyascii.pycascii.pyohas_key.pyhas_key.pychas_key.pyopanel.pypanel.pycpanel.pyotextpad.pytextpad.pyctextpad.pyowrapper.pywrapper.pycwrapper.pyodbhash.pydbhash.pycdbhash.pyodecimal.pydecimal.pycdecimal.pyodifflib.pydifflib.pycdifflib.pyodircache.pydircache.pycdircache.pyodis.pydis.pycdis.pyodistutilsREADME__init__.py__init__.pyc__init__.pyoarchive_util.pyarchive_util.pycarchive_util.pyobcppcompiler.pybcppcompiler.pycbcppcompiler.pyoccompiler.pyccompiler.pycccompiler.pyocmd.pycmd.pyccmd.pyocommand__init__.py__init__.pyc__init__.pyobdist.pybdist.pycbdist.pyobdist_dumb.pybdist_dumb.pycbdist_dumb.pyobdist_msi.pybdist_msi.pycbdist_msi.pyobdist_rpm.pybdist_rpm.pycbdist_rpm.pyobdist_wininst.pybdist_wininst.pycbdist_wininst.pyobuild.pybuild.pycbuild.pyobuild_clib.pybuild_clib.pycbuild_clib.pyobuild_ext.pybuild_ext.py.debug-buildbuild_ext.pycbuild_ext.pyobuild_py.pybuild_py.pycbuild_py.pyobuild_scripts.pybuild_scripts.pycbuild_scripts.pyocheck.pycheck.pyccheck.pyoclean.pyclean.pycclean.pyocommand_templateconfig.pyconfig.pycconfig.pyoinstall.pyinstall.pycinstall.pyoinstall_data.pyinstall_data.pycinstall_data.pyoinstall_egg_info.pyinstall_egg_info.pycinstall_egg_info.pyoinstall_headers.pyinstall_headers.pycinstall_headers.pyoinstall_lib.pyinstall_lib.pycinstall_lib.pyoinstall_scripts.pyinstall_scripts.pycinstall_scripts.pyoregister.pyregister.pycregister.pyosdist.pysdist.pycsdist.pyoupload.pyupload.pycupload.pyoconfig.pyconfig.pycconfig.pyocore.pycore.pyccore.pyocygwinccompiler.pycygwinccompiler.pyccygwinccompiler.pyodebug.pydebug.pycdebug.pyodep_util.pydep_util.pycdep_util.pyodir_util.pydir_util.pycdir_util.pyodist.pydist.pycdist.pyoemxccompiler.pyemxccompiler.pycemxccompiler.pyoerrors.pyerrors.pycerrors.pyoextension.pyextension.pycextension.pyofancy_getopt.pyfancy_getopt.pycfancy_getopt.pyofile_util.pyfile_util.pycfile_util.pyofilelist.pyfilelist.pycfilelist.pyolog.pylog.pyclog.pyomsvc9compiler.pymsvc9compiler.pycmsvc9compiler.pyomsvccompiler.pymsvccompiler.pycmsvccompiler.pyospawn.pyspawn.pycspawn.pyosysconfig.pysysconfig.py.debug-buildsysconfig.pycsysconfig.pyotext_file.pytext_file.pyctext_file.pyounixccompiler.pyunixccompiler.py.distutils-rpathunixccompiler.pycunixccompiler.pyoutil.pyutil.pycutil.pyoversion.pyversion.pycversion.pyoversionpredicate.pyversionpredicate.pycversionpredicate.pyodoctest.pydoctest.pycdoctest.pyodumbdbm.pydumbdbm.pycdumbdbm.pyodummy_thread.pydummy_thread.pycdummy_thread.pyodummy_threading.pydummy_threading.pycdummy_threading.pyoemail__init__.py__init__.pyc__init__.pyo_parseaddr.py_parseaddr.pyc_parseaddr.pyobase64mime.pybase64mime.pycbase64mime.pyocharset.pycharset.pyccharset.pyoencoders.pyencoders.pycencoders.pyoerrors.pyerrors.pycerrors.pyofeedparser.pyfeedparser.pycfeedparser.pyogenerator.pygenerator.pycgenerator.pyoheader.pyheader.pycheader.pyoiterators.pyiterators.pyciterators.pyomessage.pymessage.pycmessage.pyomime__init__.py__init__.pyc__init__.pyoapplication.pyapplication.pycapplication.pyoaudio.pyaudio.pycaudio.pyobase.pybase.pycbase.pyoimage.pyimage.pycimage.pyomessage.pymessage.pycmessage.pyomultipart.py�x��������������������X1
@r?t.co���������������CKrat�$����������������
CC
� upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php4


7.3.33-11.el8.remi7.3.33-11.el8.remi7.3.33-11.el8.remi
20-intl.iniintl.so/etc/opt/remi/php73/php.d//opt/remi/php73/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu
ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=12a1736e4b47705c924a0e75491aff17ded4c73e, strippedhttps://forum.remirepo.net/utf-80ae1ec4c6efb28550c6cf9f4810ec266341c669bb058fa6c5edec407a71d46bf?���p
|�
6
�.�1�Cd9l��I�3
!k8��#��+���UP�Y_sZd�

	UP�Y_sZ��-��?:k�X[��%~1ot�f��
3V�藛e�p��x;'��B�>�������|�
��t4b�g
�p9�5)'��R:�-a ?c��v�8ds�}��%hEP��oe�_i�#�Lcbw`��<+�H_p+�KB�J6w�,M���CY��;��[�i��'���p�]�E�Lڣ��s�
ǢP���(���� �ߎr#e�� ��=�Bm��K")-F��BT"4c}D����B�o�����i����
�J���ে��y��Sҷs��Ë�# �<��><�Y�ӋcӠ��Ĺ�b�QG�\�I&J�t�5�������VS��-2v�۹�Ո���@���NE0��.�J�E���,�dޢ����	�ة�|
5|)�mj�0��`T֙�|����ܱ��_�z�N�4�h�w��2K:t���-3EӨP]�/��ʽ�_�=t����9yW�m�����:qz 56�GW$tn�̑�bv{���ٻ����LAAg
3���+f3f45953aa18780c8e1e589536ddf8f2965848437c90668caad1a7c29c3720868292b2696aa50cc06e21ad466442852ec5826bcegz�Pgk10]
- tcp: move app_limited init to tcp_disconnect() (Jiri Benc) [1882710]
- tcp: move retrans_out, sacked_out, tlp_high_seq, last_oow_ack_time init to tcp_disconnect() (Jiri Benc) [1882710]
- tcp: do not clear urg_data in tcp_create_openreq_child (Jiri Benc) [1882710]
- tcp: move snd_cwnd & snd_cwnd_cnt init�x�������������h�������X2

-�?: ad`�������U� htt�$E����������������
U�V�T�
� regenerate the autotool
intermediates patch (patch 300)- fix sparc building by excluding failing tests RHBZ#711584- fix compile on ARM by excluding failing tests on arm - RHBZ #706253- fix "import decimal" in the Turkish locale (patch 131; rhbz#694928)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Switch from setting OPT to setting EXTRA_CFLAGS so we don't overwrite the
  DNDEBUG flag- for now, drop "obsoletes" of python-argparse, since it interracts badly with
multilib (rhbz#667984)- obsolete/provide python-argparse (new in 2.7)- fix the ppc build of the debug configuration (patch 130; rhbz#661510)- 2.7.1, reworking patch 0 (config), patch 102 (lib64); drop upstream
patch 56 (cfgparse), patch 110 (ctypes/SELinux/noexecmem), patch 119 (expat
compat), patch 123 (2to3 on "from itertools import *")
- fix test_abc's test_cache_leak in the debug build (patch 128)
- drop _weakref.so from manifest (_weakref became a core module in r84230)- Rebuilt for gcc bug 634757- fix test_structmember on 64bit-bigendian (patch 127)- fix dbm_contains on 64bit-bigendian (patch 126; rhbz#626756)- backport a patch to fix a change in behaviour in configparse.- move most of the payload of the core package to the libs subpackage, given
that the libs aren't meaningfully usable without the standard libraries- add %check section
- update lib64 patch (patch 102) to fix expected output in test_site.py on
64-bit systems
- patch test_commands.py to work with SELinux (patch 124)
- patch the debug build's usage of COUNT_ALLOCS to be less verbose (patch 125)- fixup missing -lcrypt to "crypt" module in config patch (patch 0)- re-enable systemtap
- cherrypick upstream patch to 2to3 for "from itertools import *"
traceback (patch 123)- disable systemtap for now (dtrace is failing on startup due to the bug
mentioned in 2.7-4)
- provide relative path to python binary when running pathfix.py
- fix parallel make (patch 122)- fix reference to pyconfig.h in sysconfig that led to failure on startup if
python-devel was not installed- add patch to fixup the new sysconfig.py for our multilib support on
64-bit (patch 103)- add machinery for regenerating the "configure" script in the face of
mismatching autoconf versions (patch 300)- 2.7 final; drop alphatag
- drop patch 117 (upstream), patch 120 (upstreamed)
- fix the commented-out __python_ver from 26 to 27- 2.7rc2
- revert r79310 (patch 121)
- remove modulator: upstream removed it in r78338
- rename mathmodule(_d).so to math(_d).so in manifests (appears to be changed
by r76861)
- _bytesio(_d).so and _filesio(_d).so were consolidated into _io(_d).so in
r73394 (upstream issue 6215)
- use the gdb hooks from the upstream tarball, rather than keeping our own
copy. The upstream version has some whitespace changes, a new write_repr for
unicode objects, and various bulletproofings for being run on older gdbs- 2.7rc1:
  - rework patches to apply against 2.7 (which among other changes has had a
whitespace cleanup of the .c code): .rhconfig (patch0), .binutils-no-dep
(patch10), .ascii-tolower (patch11), .socketmodule (patch13), .socketmodule2
(patch14), .systemtap (patch55), .lib64 (patch102), .selinux (patch110),
.no-static-lib (patch111), .debug-build (patch112), .statvfs-f-flag-constants
(patch114), ..CVE-2010-2089 (patch117)
  - drop upstream patches: .expat (patch3), .brprpm (patch51), .valgrind
(patch52), .db48 (patch53), .CVE-2010-1634 (patch 116), .CVE-2008-5983 (patch
118)- Stop python bailing out with an assertion failure when UnicodeDecodeErrors
occur on very large buffers (patch 120, upstream issue 9058)- Fix an incompatibility between pyexpat and the system expat-2.0.1 that led to
a segfault running test_pyexpat.py (patch 119; upstream issue 9054)- add a flag to make it easy to turn off the debug build when troubleshooting
the rpm build- reading the timestamp counter is available only on some arches (see Python/ceval.c)
- disable --with-valgrind on s390(x) arches- ensure that the compiler is invoked with "-fwrapv" (rhbz#594819)
- CVE-2010-16�x���������������������X3
 6�?t LS�����������-64,�$����������������
���
� up memory problems and fix tty handling.- Add manual context selection to pam_selinux- Add pam_selinux- Add SELinux support- pam_postgresok: add
- pam_xauth: add "targetuser" argument- pam_succeed_if: fix thinko in argument parsing which would walk past the
  end of the argument list- reapply:
  - set handler for SIGCHLD to SIG_DFL around *_chkpwd, not SIG_IGN- pam_timestamp: fail if the key file doesn't contain enough data- update to 0.77 upstream release
  - pam_limits: limits now affect root as well
  - pam_nologin: returns PAM_IGNORE instead of PAM_SUCCESS unless "successok"
    is given as an argument
  - pam_userdb: correctly return PAM_AUTH_ERR instead of PAM_USER_UNKNOWN when
    invoked with the "key_only" argument and the database has an entry of the
    form "user-<wrongpassword>"
- use a bundled libdb for pam_userdb.so because the system copy uses threads,
  and demand-loading a shared library which uses threads into an application
  which doesn't is a Very Bad Idea- pam_timestamp: use a message authentication code to validate timestamp files- rebuild- modify calls to getlogin() to check the directory of the current TTY before
  searching for an entry in the utmp/utmpx file (#98020, #98826, CAN-2003-0388)- rebuilt- set handler for SIGCHLD to SIG_DFL around *_chkpwd, not SIG_IGN- rebuilt- pam_xauth: reintroduce ACL support, per the original white paper
- pam_xauth: default root's export ACL to none instead of everyone- create /lib/security, even if it isn't /%{_lib}/security, because we
  can't locate /lib/security/$ISA without it (noted by Arnd Bergmann)
- clear out the duplicate docs directory created during %install- fix syntax errors in pam_console's yacc parser which newer bison chokes on
- forcibly set FAKEROOT at make install time- patch to interpret $ISA in case the fist module load attempt fails
- use $ISA in default configs- Since cracklib-dicts location will not be correctly detected without 
  that package being installed, add buildreq for cracklib-dicts.
- Add patch57: makes configure use $LIBNAME when searching for cracklib 
  dicts, and error out if not found.- Fixed pam config files- Added fix to install libs in correct directory on 64bit machine- pam_timestamp_check: check that stdio descriptors are open before we're
  invoked
- add missing chroot.conf- pam_timestamp: sundry fixes, use "unknown" as the tty when none is found- pam_timestamp_check: be as smart about figuring out the tty as the module is- pam_timestamp_check: remove extra unlink() call spotted by Havoc- pam_timestamp: chown intermediate directories when creating them
- pam_timestamp_check: add -d flag to poll- pam_timestamp: add some sanity checks
- pam_timestamp_check: add- pam_timestamp: add a 'verbose' option- rebuild with db4
- just bundle install-sh into the source package- pam_unix: be more compatible with AIX-style shadowing (#19236)- libpam_misc: fix possible infinite loop in misc_conv (#62195)
- pam_xauth: fix cases where DISPLAY is "localhost:screen" and the xauth
  key is actually stored using the system's hostname (#61524)- rebuild- rebuild- include the pwdb config file- adjust the pwdb-static patch to build pam_radius correctly (#59408)- change the db4-devel build dependency to db3-devel- rebuild- pam_unix: log successful password changes
- remove pam_timestamp- fix pwdb embedding
- add pam_timestamp- swallow up pwdb 0.61.1 for building pam_pwdb- pam_userdb: build with db4 instead of db3- pam_stack: fix some memory leaks (reported by Fernando Trias)
- pam_chroot: integrate Owl patch to report the more common causes of failures- fix a bug in the getpwnam_r wrapper which sometimes resulted in false
  positives for non-existent users- include libpamc in the pam package (#55651)- pam_xauth: don't free a string after passing it to putenv()- pam_xauth: always return PAM_SUCCESS or PAM_SESSION_ERR instead of PAM_IGNORE,
  matching the previous behavior (libpam treats PAM_IGNORE from a single module
  in a stack as a session error, leading to false erro�x�������������X��������X4
py�?ist_P�Ht.pyc�$����������������


�ippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6b6108665a2a05ba11151a5b84c564445ec114fa, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=965a680e42ef712744949697138cd64589322c6c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6057846ff0e17a17c5769a6b1788702fd5ea8322, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8549324f50db32558c073df60645b7fc1d13fc94, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f85095d298b92fdfcdf17f95f09ebba9e8b8b609, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6b4254c60d9e184e4a9eb5c883c2afb2f9a4686a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ed52acd9bb3af0b4c42900163fc260edf3935a5b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=889da55849c98b4373f87c792d7341251e4084b4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=68287b495e1454221a09b65311623d86a2538e0b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b257f78554c55c4d35e13fe0bebc529275876505, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0149743a3bcbb8f4b4e6e0948edd404781cf5895, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e0c18106b8bfb0db258552a6d8f349996f74d4a0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b14578213a361bbd1cb2da67516c03662198e25b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=72e43430d5b2cc789c6d5c6240013aa397b745ec, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=650cbf1948f69ad9de311f3a501519f343618e02, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fe16f4af0cf41e838cc8a8866b9c2d7d70b9877a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cd4e3cf9d616d4a2a9a12cd155354deafdf37761, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=03252dc20769eb089c68ddb19cec83d250342aea, strippedHTML document, UTF-8 Unicode text, with very long linesUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)
�x��������������������X5
�?P�������خO��$_����������������
O�P�N�
� libpython.so- changed DESTDIR to point to / so that distutils will install dynload
  modules properly in the installroot- 2.2b2- python2ify- 2.2b1- 2.2a4
- Enable UCS4 support
- Enable IPv6
- Provide distutils
- Include msgfmt.py and pygettext.py- Obsolete Distutils, which is now part of the main package
- Obsolete python2- Add docs, tools and tkinter subpackages, to match the 1.5 layout- 2.2a3
- don't build tix and blt extensions- Add tk and tix to build dependencies- 2.1.1 bugfix release - with a GPL compatible license- Add new build dependencies (#49753)- build with -fPIC- 2.1
- reorganization of file includes- fix the "requires" clause, it lacked a space causing problems
- use %{_tmppath}
- don't define name, version etc
- add the available patches from the Python home page- added devel subpackage- modify all files to use "python2.0" as the intrepter
- don't build the Expat bindings
- build against db1- updated for 2.0 final- updated for 2.0c1
- build audioop, imageop, and rgbimg extension modules
- include xml.parsers subpackage
- add test.xml.out to files list- added bin/python2.0 to files list (suggested by Martin v. L?)- updated for release 1 of 2.0b2
- use .bz2 version of Python source- Version 2 of 2.0b1
- Make the package relocatable.  Thanks to Suchandra Thapa.
- Exclude Tkinter from main RPM.  If it is in a separate RPM, it is
  easier to track Tk releases.















































































































	

 !"#$%&'()*+,-./0123456789:;<=@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdghijklmnopqrs���2.72.72.72.7.18-17.module+el8.10.0+1813+4b021305.rocky.0.22.7.18-17.module+el8.10.0+1813+4b021305.rocky.0.2



























































































python2-configpython2.7-configPython-ast.hPython.habstract.hasdl.hast.hbitset.hboolobject.hbufferobject.hbytearrayobject.hbytes_methods.hbytesobject.hcStringIO.hcellobject.hceval.hclassobject.hcobject.hcode.hcodecs.hcompile.hcomplexobject.hdatetime.hdescrobject.hdictobject.hdtoa.henumobject.herrcode.heval.hfileobject.hfloatobject.hframeobject.hfuncobject.hgenobject.hgraminit.hgrammar.himport.hintobject.hintrcheck.hiterobject.hlistobject.hlongintrepr.hlongobject.hmarshal.hmemoryobject.hmetagrammar.hmethodobject.hmodsupport.hmoduleobject.hnode.hobject.hobjimpl.hopcode.hosdefs.hparsetok.hpatchlevel.hpgen.hpgenheaders.hpy_curses.hpyarena.hpycapsule.hpyconfig.hpyctype.hpydebug.hpyerrors.hpyexpat.hpyfpe.hpygetopt.hpymacconfig.hpymactoolbox.hpymath.hpymem.hpyport.hpystate.hpystrcmp.hpystrtod.hpythonrun.hpythread.hrangeobject.hsetobject.hsliceobject.hstringobject.hstructmember.hstructseq.hsymtable.hsysmodule.htimefuncs.htoken.htraceback.htupleobject.hucnhash.hunicodeobject.hwarni�x�������������H��������X6
co�? 12:����`��������has <�$p����������������
�h�h�h
��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpython-setuptools-39.2.0-9.el8_10.src.rpm�����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x����������������������X7
�?
L��(C�
�$,����������������
���
�org> - 1.1.5-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.5-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.5-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.5-3Fedora Release Engineering <rel-eng@fedoraproject.org> - 1.1.5-2Andreas Bierfert <andreas.bierfert[AT]lowlatency.de>Adam Jackson <ajax@redhat.com> - 1.1.4-4Mike A. Harris <mharris@redhat.com> 1.1.4-3.fc6Mike A. Harris <mharris@redhat.com> 1.1.4-2.fc6Mike A. Harris <mharris@redhat.com> 1.1.4-1.fc6Dmitry V. Levin <ldv@altlinux.org> 1.1.4-alt1Dmitry V. Levin <ldv@altlinux.org> 1.1.3-alt1Dmitry V. Levin <ldv@altlinux.org> 1.1.2-alt1Dmitry V. Levin <ldv@altlinux.org> 1.1.1-alt1Dmitry V. Levin <ldv@altlinux.org> 1.1.0-alt1Dmitry V. Levin <ldv@altlinux.org> 1.0.7-alt1Dmitry V. Levin <ldv@altlinux.org> 1.0.6-alt1Dmitry V. Levin <ldv@alt-linux.org> 1.0.5-alt1Dmitry V. Levin <ldv@alt-linux.org> 1.0.4-alt1Dmitry V. Levin <ldv@alt-linux.org> 1.0.3-alt1Dmitry V. Levin <ldv@alt-linux.org> 1.0.2-alt1Dmitry V. Levin <ldv@alt-linux.org> 1.0.1-alt1Dmitry V. Levin <ldv@alt-linux.org> 1.0.0-alt1Dmitry V. Levin <ldv@altlinux.ru> 0.5.2-alt4Dmitry V. Levin <ldv@altlinux.ru> 0.5.2-alt3Sergie Pugachev <fd_rag@altlinux.ru> 0.5.2-alt1AEN <aen@logic.ru>Thierry Vignaud <tvignaud@mandrakesoft.com> 0.5.1-4mdkPixel <pixel@mandrakesoft.com> 0.5.1-3mdkChristopher Molnar <molnarc@mandrakesoft.com> 0.5.1-2mdkChmouel Boudjnah <chmouel@mandrakesoft.com>Bernhard Rosenkraenzer <bero@mandrakesoft.com>Jeff Johnson <jbj@redhat.com>- build with hardening LDFLAGS (#1548717)
- remove obsolete macro and comments
- add gcc to build requirements- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- compile with PIE and RELRO flags (#853176)- update to 1.1.6
- fix license tag
- remove unnecessary macros- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Autorebuild for GCC 4.3- 1.1.5-1
- version upgrade
- fix #246063- Rebuild for build id- Create 'utempter' group with official allocated GID==35 (from setup package).- Removed usage of rpm macros inside the spec changelog (#200051)
- Removed non-UTF-8 chars from changelog.- Initial build of Dimitry's libutempter replacement for Fedora Core.
- Reworked the upstream spec file for Fedora packaging compliance.
- Removed static lib subpackage as we dont ship those.- Enabled almost all diagnostics supported by gcc and fixed all
  issues found by gcc-3.4.4-alt3.
- Added FreeBSD support, based on patches from Gentoo/FreeBSD.
- Makefile:
  + Fixed few portability issues reported by Gentoo developers.
- libutempter: Linked with -Wl,-z,defs.
- utempter:
  + Fixed struct utmp initialization on 64-bit architectures
    with 32-bit backwards compatibility enabled (like x86_64).
  + Linked with -Wl,-z,now, i.e., marked it to tell the dynamic
    linker to resolve all symbols when the program is started.
    Suggested by Gentoo developers.- Restricted list of global symbols exported by the library.
- Updated FSF postal address.- Added multilib support.- iface.c: don't block SIGCHLD; redefine signal handler instead.- Changed soname back to libutempt�x�������������8y�������X8
 o�?tc/t����������������4/php�$j����������������
�4�4�4
�aries, dynamic
  with system libraries.  Link with the bundled zlib.- Modified RPM spec to match new 5.1 debug+max combined community packaging.- Added "client/mysqlslap"- Added zlib to the list of (static) libraries installed
- Added check against libtool wierdness (WRT: sql/mysqld || sql/.libs/mysqld)
- Compile MySQL with bundled zlib
- Fixed %packager name to "MySQL Production Engineering Team"- Avoid using the "bundled" zlib on "shared" builds:
  As it is not installed (on the build system), this gives dependency
  problems with "libtool" causing the build to fail.
  (Change was done on Nov 11, but left uncommented.)- Extend the file existence check for "init.d/mysql" on un-install
  to also guard the call to "insserv"/"chkconfig".- added more man pages- Made yaSSL support an option (off by default)- Enabled yaSSL support- Give mode arguments the same way in all places
lenz@mysql.com>

- fixed the removing of the RPM_BUILD_ROOT in the %clean section (the
  $RBR variable did not get expanded, thus leaving old build roots behind)- Fixed the creation of the mysql user group account in the postinstall
  section (BUG 12348)
- Fixed enabling the Archive storage engine in the Max binary- Fixed the Requires: tag for the server RPM (BUG 12233)- create a "mysql" user group and assign the mysql user account to that group
  in the server postinstall section. (BUG 10984)- Do not build statically on i386 by default, only when adding either "--with
  static" or "--define '_with_static 1'" to the RPM build options. Static
  linking really only makes sense when linking against the specially patched
  glibc 2.2.5.- added mysql_client_test to the "bench" subpackage (BUG 10676)
- added the libndbclient static and shared libraries (BUG 10676)- use "mysqldatadir" variable instead of hard-coding the path multiple times
- use the "mysqld_user" variable on all occasions a user name is referenced
- removed (incomplete) Brazilian translations
- removed redundant release tags from the subpackage descriptions- Added a "make clean" between separate calls to "BuildMySQL".- Removed the mysql_tableinfo script made obsolete by the information schema- Enabled the "blackhole" storage engine for the Max RPM- removed the MySQL manual files (html/ps/texi) - they have been removed
  from the MySQL sources and are now available seperately.- old mysqlmanager, mysq* Mon Feb 7 2005 Tomas Ulin <tomas@mysql.com>

- enabled the "Ndbcluster" storage engine for the max binary
- added extra make install in ndb subdir after Max build to get ndb binaries
- added packages for ndbcluster storage engine- replaced obsoleted "BuildPrereq" with "BuildRequires" instead- enabled the "Federated" storage engine for the max binary- ISAM and merge storage engines were purged. As well as appropriate
  tools and manpages (isamchk and isamlog)- enabled the "Archive" storage engine for the max binary
- enabled the "CSV" storage engine for the max binary
- enabled the "Example" storage engine for the max binary- MySQL-Max now requires MySQL-server instead of MySQL (BUG 3860)- do not link statically on IA64/AMD64 as these systems do not have
  a patched glibc installed- Added libmygcc.a to the devel subpackage (required to link applications
  against the the embedded server libmysqld.a) (BUG 4921)- Added EXCEPTIONS-CLIENT to the "devel" package- disabled OpenSSL in the Max binaries again (the RPM packages were the
  only exception to this anyway) (BUG 1043)- fixed server postinstall (mysql_install_db was called with the wrong
  parameter)- added mysql_tzinfo_to_sql to the server subpackage
- run "make clean" instead of "make distclean"- added ncurses-devel to the build prerequisites (BUG 3377)- when using gcc, _always_ use CXX=gcc
- replaced Copyright with License field (Copyright is obsolete)- added myisam_ftdump to the Server package- link the mysql client against libreadline instead of libedit (BUG 2289)- marked /etc/logrotate.d/mysql as a config file (BUG 2156)- fixed file permissions (BUG 1672)- made testing for gcc3 �x��������������h�������X9
m>�?.3-1(���������_alin�$o����������������
_�_~_
�network.target'
  in dhcpd[6].service should take care of the original problem (#565921)- don't ship legacy SysV initscripts
- dhcpd6: move '-cf /etc/dhcp/dhcpd6.conf' from sysconfig/dhcpd6 to dhcpd6.service
- run 'chown -R dhcpd:dhcpd /var/lib/dhcpd/' before starting dhcpd/dhcpd6 service
  for the case where leases file is owned by root:root as a
  consequence of running dhcpd without '-user dhcpd -group dhcpd' (#744292)- 4.2.3-P1: fix for CVE-2011-4539 (#765681)- Send DHCPDECLINE and exit(2) when duplicate address was detected and
  dhclient had been started with '-1' (#756759).
- Don't build with -D_GNU_SOURCE, configure.ac uses AC_USE_SYSTEM_EXTENSIONS- rebuild against new bind- dhclient-script: arping address in BOUND|RENEW|REBIND|REBOOT (#752116)- Rebuilt for glibc bug#747377- Write lease file AFTER changing of the effective user/group ID.
- Move omshell from dhcp-common to main package (where it originally was).- Write PID file BEFORE changing of the effective user/group ID.
- Really define _hardened_build this time- 4.2.3- 4.2.3rc1- change ownership of /var/lib/dhcpd/ to dhcpd:dhcpd (#744292)
- no need to drop capabilies in dhcpd since it's been running as regular user- 56dhclient: ifcfg file was not sourced (#742482)- dhclient-script: address alias handling fixes from Scott Shambarger (#741786)- dhclient-script: do not backup&restore /etc/resolv.conf and /etc/localtime.- SystemTap support: spec file change, some dummy probes, tapset, simple script- Support for IPoIB (IP over InfiniBand) interfaces (#660681)
- Hopefully last tweak of adding of user and group (#699713)- PIE-RELRO.patch is not needed anymore, defining _hardened_build does the same
- One more tweak of adding of user and group (#699713)- rebuild against new bind- Fix adding of user and group (#699713)- Tighten explicit libs sub-package requirement so that it includes
  the correct architecture as well.- #699713:
  - Use '--enable-paranoia --enable-early-chroot' configure flags
  - Create/delete dhcpd user in %post/%postun
  - Run dhcpd/dhcpd6 services with '-user dhcpd -group dhcpd'- 4.2.2: fix for CVE-2011-2748, CVE-2011-2749 (#729850)- Do not ship default /etc/dhcp/dhclient.conf (#560361,c#9)- Improve capabilities patch to be able to run with PARANOIA & EARLY_CHROOT (#699713)- 4.2.2rc1- 4.2.2b1: upstream merged initialization-delay.patch
- Drop all capabilities in dhcpd/dhcrelay (#699713)- Removed upstream-merged IFNAMSIZ.patch
- Polished patches according to results from static analysis of code.- Add triggerpostun scriptlet tied to dhcp-sysvinit
- Make it possible to build without downstream patches (Kamil Dudka)- Fix typo in triggerun scriptlet (#705417)- Packages dhcp/dhclient/dhcp-common explicitly require the libs sub-package
  with the same version and release (bug #705037).
- Fix triggerun scriptlet- Fix 11-dhclient to export variables (#702735)- Comply with guidelines for systemd services- Fix NetworkManager dispatcher script for dhcpd to support arbitrary interface names- Better fix for CVE-2011-0997: making domain-name check more lenient (#694005)- 4.2.1-P1: fix for CVE-2011-0997 (#694005)- Polished patches according to results from static analysis of code.- rebuild (bind)- 4.2.1- 4.2.1rc1
- Fixed typo in dhclient.leases(5) (#676284)- rebuild against new bind-libs-lite- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Prevent anything under _docdir from being scanned. (#674058)- dhclient-script improvements, thanks to Ville Skyttä (#672279)- 4.2.1b1: fix for CVE-2011-0413 (#672996)
- No longer need invalid-dhclient-conf, parse_date and release6-elapsed patches- Fix loading of configuration when LDAP is used (#668276)- Fix OMAPI (#666441)- Provide default /etc/dhcp/dhclient.conf
- Client always sends dhcp-client-identifier (#560361)- Add dhcp-common subpackage (#634673)- 4.2.0-P2: fix for CVE-2010-3616 (#662326)
- Use upstream fix for #628258
- Provide versioned symbols for rpmlint- Porting dhcpd/dhcpd6/dhcrelay services from SysV to Systemd- Re�x�������������(X�������X:
�?Bh4����$;����������������
���

�I8t?5�d
�
�
�
�	'
�	J
��
��
�

�

�
I
�
R
�	
^
�
t
�
�
�
�

�	@
t��
�	8	�
<

l
���
;(
�
8
�^9^:z^B+�
G+�H,LI,�X,�Y,�Z-`
[-d
\-l]-�^/b0p
d1�
e1�
f1�
l1�
t1�u2Lv2�w4x4|y4�
�5
�5
�58
�5>
�5�


5�

5�
5�6

7�

8
�8H

8L8h
g8l
h8p
Cphp74-php-pecl-zip1.22.31.el8.remiA ZIP archive management extensionZip is an extension to create and read zip files.

Package built with libzip 1.10.1.

Package built for PHP 7.4 as Software Collection (php74 by remi).eS�7builder.remirepo.netL�Remi's RPM repository <https://rpms.remirepo.net/> #StandWithUkrainePHP-3.01Remi ColletDevelopment/Languageshttps://pecl.php.net/package/ziplinuxx86_64/
H #
*
9��
�6
��
�
vl)�01��0����A큤A큤����������������������������������A큤��eS�5eS�5eS�5eS~~eS�5eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS~~eS�7eS~~eS�52e16cadf8125dfe984e3fdb39241662f5e0096a9e7380592242cabbba2b5ebf011c874441f01608275a63af5d1e9439ba7dd4720b507325e66c2312033222531ce4bc3cd8387b3c97aece797f96c0932024a75ff51e60dd8cd9cac67b2a9f852438d3b9e496b8c3089df24d1bbb7fff14a8a61b247d6b08679eac83c50e309a99d82e4e318b4851d2fe99dc82e767dfb4c4534bb5ce125b7ff5c70ad32f2ab5d086527a14becf9aec363fcd01975da8a2c7023a0e6100bf4b22313484fc60e098e0603a7771163d963d67e006673d22b7560626e1c7e1552ce6758f5bad688cf8739306cf157aa2413d7e318f098c643922c60fd801bcb0028f4ac8a48c283695cc674f0fb41436b792280c274a0f22a3269dae47d9451892cd71b6d30c58e29d90ac3a6c815df221b211ccd278cd776796e1d8c6c909ddf7540a2528039a3f18b26bf6847c38e7c179c4cc679ef49d6b1f66fd59a94517b4b37b979b141dd1e52ff48549e9b4bc9d20c017a4a505016486370543b0ef01a3be0053a43671dba9dbe5baac3c46851c18d2ea66e0ab787cb5b86d908f42a4d89e01a9ae66f06155db34aa0c5096c67a5ab3348cf3bab411b42e2988621f6920b172c7161868ae363e5f881a0613d1b54a7c07649433d1ce825f13da1cc9d63e197519a44a237c677f1ccba4715875b1c7343e7c3ae588d1107feba33ab5b61767318659fbede447d7fce03ea4fb8be2f08c91a8abeac82d201146e3ecb66a7cdfae2c1132c1daa66c568f066021472c63b4a98c3a46e4b4e607e9080aec3efa350416ea11d5857841910e1bb78a3a21a0dd48ed2f7e7f3ce7b2b9b91ff54ce6cb96dd6d4572b59a33bc26dd3d4ca320ce9e823121db1a53c75e99999468869a6118f87c4337a1a10a8e11191687e96e055746dbd7b72f8795807f001e84ce6ce185e7a2d25d8f4d8d3ec04702c55302a070a040ed7a91980d1468777e7882390b23945baae5f7bf07c9abdfe630cccd508867f8a83d0c4aa4a636ac4d6a6daabc9366e87cd84ed�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootphp74-php-pecl-zip-1.22.3-1.el8.remi.src.rpm��������������������������������������������������������������������������������������������������������config(php74-php-pecl-zip)php74-php-pecl(zip)php74-php-pecl(zip)(x86-64)php74-php-pecl-zipphp74-php-pecl-zip(x86-64)p�x��������������G�������X;
42�	?e6c5xD
@Z������'5e401�$7����������������
'5&5(5
�008abde2d10e31732cd0b268a76a02002529111cca16ceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f150843dad2cc752ab721cd9a9f36ece70fb53ab7713551f2d3d8694d8e8c5a06d6e2aac73b3148f6d1d7111dbca32099f68d26c644c6813ae1e4f05f6579aa2663fe602c4c7482de6479dd2e9793cda275e5e63d773dacd1eca689232ab7008fb4fb693ec0a662b39f995a4f252b03a6222945470c1b6f12ca02918e4efe0df64b9fdfa9c076ed11faf6ee11c268cef322527f9aeafb207f76cf9f17801bd6ba16412c59e751927fee19df3deec46132d16345f0a53821396636d56775bc2077bec265768cf800bf767ce4d6c50075057f6ccac8306eb323e1ad84568490d916b20528d693f929f62b8bb135a11b7ba9987439f7a960cc969e32f8cb567c1ef79c97241a1a74641d2fb1f9edf53b8152384b0385c8bd87797f811bd83935e89f84bdbf8a45fd7719eaca7f6fb6257cfd9e240e25342724787d8d0b337a5985cd9c4718d409519f61a4ab3621260b41f037165c068ee5914dd869b125cb98e7b1ea3ea8ee2c42eaf1efd93ee723a1e149d46469b9d73a1dd3045725c873d25d3add3a39896f829af350bcd996c7f7c984ec77a554572426a6c6c78e025d367b324701ac2be7c1bd33d1508a9fb63dd881100283c4aeb00d5911327587e5652351adaa6e0ae3075497daf5d7fab99f1bb0383ea1a4abe8aca9055719a66d8d61c0823da026bb7996eabc7b10d6905e0ff38e7e71b155a65b09f5a700a9c7a8ec8f7f57c3322c01230f7c5b9312808f49b7dbb8debb06094b76f10d4dfb7c8fe7d00ce310d631c6eb3842d4614052413797b380a82b8acf3b3068fc9f356172e1371328b82776b62c05ffec1d8e0af619230707aa3a10abad1c5874e777de3a3264296870566d0e9a8de4f373a355fdb66f0df160d5e57f35191157b97454b23c85b45e9d2aad80ee4c2557ff51492fc3db5ecf5d338469ec187ab6e0e3f55f618a39eed42362362ab1021cf07f36897054f4335bed6bf88428f922c8edfa7ab71dd5dc490c2809388d1eb5a30d03856a0dc6ce7586e4af4258cd408b3a89e2eb1345b65a1f372edbf145f3c70be648c5252e08e16a231d4a4ff8de0bd8300ad2ebd5f669d59a6b095e9687bd4f405cb5e8dc725c9b139d5dc1bf8298bfdbd1feb3062525afc63330c172cffc3763e9994d9d77ab2ccdb261df13fe4eb37cf0c9102c12c85b8778ef2a0cf45b1f607d249b56e75c0455f86ed75485b379611c11c6c8f098dee2ae5ccee916dcdd4203aa5c92c1a5b92a80a7dbc37c80a4b7961f5611483a2bf1e64f4370053f052c92c44422c39b44d69733fa58e616999700f66a26b2ceb15586db67fa973c1c7991663478db3f978a7151bc16537ed18bacf8ea30c05591c3f14f29dc6d342f2792d08998dfa8aeed30b4456ee7c7d7f6042380c90bead660878e22a52fd4589e9a9ae797c5cf312177487c5b5da6f9e1ae2fa8c57bb3da0a090db2705757a0445d4b58a669fb9e4a406c2fd92f6f27e085a6ae67d62b2b99576f7eb0d5991ec94b9fe40505faf4c9fb228867c10d7007ab4df9571122e98aef33fd2a8dc78cb2dbe61c19898dab6df99fb2ec9364b2dc1ce32f49d99a93492ee60b6c256b7798b7dc5053996c0bff9e43c3b24f9122e5497f50ee82f42c88fa0aceb0b401fe17e78493e81bd74d39d27b660e81d22529cc2a30878e47355a2e4634cbd2fc5bca2900bfee543f1bc922b13f6de9490b446cb392b572b12cfe4505d5419e440db984af47b92a6e0eaab04ac475d44305109914647ddcfb517940365fadd8660cb293792111bae0d41c14d5f8487121893d9a3a70706e5644c2efcc232606ffaab6e83982053ee159dd6e3acecafacecc6796b38cc1aa45a49b8c1b4e6e09cceba9f522e741df87055eb5da98da64fdbd9a8224fdf6a1b3da0a090db2705757a0445d4b58a669fb9e4a406c2fd92f6f27e085a6ae67d6babb94a5a2cb8e01b9cf6b1c90d1714b94f225184b710e3369c9257dd884a3c0dad882019ce21b66ccb1af4a7b4e61618f04022c9ccf13abbe808c152fcbcb7fb3da0a090db2705757a0445d4b58a669fb9e4a406c2fd92f6f27e085a6ae67d641a72f9f20357dc5d66d20004828a874755c4d8c2468c773aba29422568eec7d4c09670c201d61a6b6dfe99bd134db14b1615b07dd045d43b5741d63d2a8a9fdaf6102b56109dc91204a91a4a5a66b31f1a1a1059d4c7227e20c8b081ef57cc8b3da0a090db2705757a0445d4b58a669fb9e4a406c2fd92f6f27e085a6ae67d6aa6f5558830f21a594942c65b1c6f96c03366827b5d5fbbecbce58ea76230bb226e7ecc6baf1789425b2258c9b1ff8e25f7414d470d7da3d91c2ad938acef13509dc69a43575955d9096b4341219e2aaf162f30a7c3c362cbc559da73cb2548632a80e24574c39770c049f9bf38b4960e3a43912fdc661141f00a95696b5936ae978ca284bcb414cd980e1722d909190ae13974b0a32bc5f2fc098c7cfe89b131242ae63d7ba505a92b90d0bbf22982a5fcbd7db4e7cd09394758488a80779479e3164cb90244abb01878ecf7952e38fcd5238b3a265ac40512cc6583d999f1cfdeb4b5b314861fd35fcd1d38b7960e6ae7ddf07242b62d7c402bf485f780e99a7a9c5ec4cc5d2ca79198153c351c484f6188ee4e2939dd64d492fb8f21f0d191fd817b6bbe83bca89badac327ead0356d648dd6f2764a7a303dcf5b10d60e24bbd31ae6f8b218c5638a5e2dbfd18ab01c5c4f4ae29289bd3�x�������������7�������X<
�?
Hj�������
�9�$B����������������
�9�9�9
�yo.ac.jp> - 1.8.74-1Akira TAGOH <tagoh@redhat.com> - 1.8.70-1- Rebuilt for https://fedoraproject.org/wiki/Fedora_33_Mass_Rebuild- Rebuilt for JDK-11, see https://fedoraproject.org/wiki/Changes/Java11- Perl 5.32 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_32_Mass_Rebuild- F-32: rebuild against ruby27- Rebuilt for https://fedoraproject.org/wiki/Fedora_31_Mass_Rebuild- Perl 5.30 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_30_Mass_Rebuild- F-30: rebuild against ruby26- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Perl 5.28 rebuild- F-29: BR javapackages-tools for java rpm macros (bug 1591153)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- F-28: rebuild for ruby25- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Perl 5.26 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- F-26: rebuild for ruby24- Perl 5.24 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- F-24: rebuild against ruby23- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Perl 5.22 rebuild- Rebuilt for GCC 5 C++11 ABI change- F-22: rebuild for https://fedoraproject.org/wiki/Changes/Ruby_2.2- Perl 5.20 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Re-enable Java bindings using openjdk
- Move jar to %_jnidir and javadocs to %_javadocdir
- Add javadoc package per current Java packaging guidelines- F-21: disable java due to gcc-java vanishment- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild- F-19: rebuild for ruby 2.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Rebuilt for c++ ABI breakage- Rebuilt for Ruby 1.9.3.- F-17: rebuild against gcc47- Perl mass rebuild- 1.8.78- Mass rebuild with perl-5.12.0- F-13: rebuild for new perl- F-12: Mass rebuild- F-11: Mass rebuild- Support LZO compression (thanks to Karsten Hopp)
- And rebuild against new perl (F-9)- Rebuild against gcc43 (F-9)- 1.8.77- 1.8.76- Mass rebuild (buildID or binutils issue)- License update- Fix java directory- 1.8.75
- Ruby subpackage description change according to Guildlines- Add JAVAC direction and perl-devel for BR- Add missing release dependency
- Change group from Development to System Environment
- Remove duplicate files and fix the dependency for main package.- Rewrite.- Initial package.




























































































	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghja�1.8.78-42.el8.remi1.8.78-42.el8.remi
	

cbcodeccbtestcrmgrcrtestcrtsvdpmgrdptestdptsvhvmgrhvtestodidxodmgrodtestqmttestrlmgrrltestvlmgrvltestvltsvqdb�x��������������&�������X=
 w�?daem�������H�W�upst�$G����������������
W�X�V�
�SLv3 when SSLv23_method is used in ssl- Update to 2.7.8- rebuilt for updated libffi ABI on ppc64le- aarch64 has valgrind, just list those that don't support it- Update to 2.7.7
- Refreshed patches: #16, #112, #138, #147, #157, #166, #173, #5000
- Dropped patches: #190, #192, #194- update the arch list where valgrind exists - %power64 includes also
    ppc64le which is not supported yet- Rebuilt for https://fedoraproject.org/wiki/Changes/f21tcl86- Fixed obsoletes on ordereddict (bz #1095434)- Obsoletes python-ordereddict (bz #1085593, not precisely 1:1 replacement)- Fix test failure with SQLite > 3.8.4.
- Obsolete/Provide python-unittest2
Related:              rhbz#1060426- Enable loading sqlite extensions.
Resolves:             rhbz#1066708- Fixed buffer overflow (upstream patch)
Resolves:             rhbz#1062375- Install macros in _rpmconfigdir.- Updated to v2.7.6
- Freshened patches 102, 111, 112, 136, and 142
- Dropped patches 186, 188 (both fixed upstream)- Make library-files user writable to get rid of
  Permission Denied in buildlog from debuginfo-packaging- enable valgrind support on 32 bit arm- Import get_python_version in bdist_rpm
Resolves:             rhbz#1029082- Fix processing gdb py-bt command in eval calls.
Resolves:             rhbz#1008154- Removed ancient Obsolete: python-sqlite2.- Sync back/renumber patches to stay consistent with rhel.- Added fix for CVE-2013-4238 (rhbz#998430)- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Fix build with libffi containing multilib wrapper for ffi.h (rhbz#979696).- Obsolete PyXML as requested in rhbz#981137.- Updated to Python 2.7.5.
- Refreshed patches: 0 (config), 102 (lib64), 121 (add Modules to build path),
153 (gdb test noise)
- Dropped patches: 126, 127 (big endian issues, both fixed upstream),
175 (configure -Wformat, fixed upstream)
- Synced patch numbers with python3.spec.- fix multilib issue in python-tools due to /usr/bin/pynche (source 7;
rhbz#831437)- Add patch that enables building on ppc64p7.- Allow arbitrary timeout in Condition.wait (rhbz#917709).- Build with libdb 5.3 instead of libdb4
- Refreshed patches: 0 (config), 102 (lib64)
- Dropped patches: 54 (db4 version), 159 (db4 include path adjustment)- Updated to Python 2.7.4.
- Refreshed patches: 0 (config), 7 (sqlite encoding), 16 (rpath in config),
55 (systemtap), 111 (no static lib), 112 (debug build), 113 (more
configuration flags), 130 (add extension to python config), 134 (fix
COUNT_ALLOCS in test_sys), 146 (haslib FIPS), 147 (add debug malloc stats),
153 (fix gdb test noise), 157 (uid, gid overflow - fixed upstream, just
keeping few more downstream tests), 165 (crypt module salt backport),
175 (fix configure Wformat), 5000 (regenerated autotooling patch)
- Dropped patches: 101 (lib64 regex; merged upstream), 171 (exception on
missing /dev/urandom; merged upstream), 172 (poll for multiprocessing socket
connection; merged upstream)- fix gcc 4.8 incompatibility (rhbz#927358); regenerate autotool intermediates- restrict scope of workaround for cmpi-bindings issue to avoid breaking
in-tree running of test_sys and test_subprocess (rhbz#817554)- add workaround for cmpi-bindings issue (rhbz#817554)- add workaround for ENOPROTOOPT seen running selftests in Koji
(rhbz#913732)- remove config flag from /etc/rpm/macros.python2- remove __debug_package macro from comment- drop -b from application of patch 157 (uid/gid overflows)- fix bogus dates in changelog- port _multiprocessing.Connection.poll() to use the "poll" syscall, rather
than "select", allowing large numbers of subprocesses (patch 172;
rhbz#849992)- raise correct exception in os.urandom() when /dev/urandom is missing
(patch 171; rhbz#907383)- in debug builds, try to print repr() when a C-level assert fails in the
garbage collector (typically indicating a reference-counting error somewhere
else e.g in an extension module) (patch 170; rhbz#850013)- move lib2to3/tests from python-libs to python-test (rhbz#850056)- use SHA-256 rather than implicitly using MD5 wit�x��������������������X>
1.�?-2R��������@4�������4[AT]�$l����������������
�4�4�4
�32-2258 1606088872





































































































































































































































































































































































































	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������










	
























 
!
"
#
$
%
&
'
(
)
*
+
,
-
.
/
0
1
2
3
4
5
6
7
8
9
:
;
<
=
>
?
@
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d
e
f
g
h
i
j
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z
{
|
}
~

�
�
�
�
�
�
�5.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el8



	

 !!"#$%&'�x���������������������X?
en�?pm@c@��������Ӟhris�$C����������������
ӞҞԞ
�Perl script to run the tests, because it will automatically check
  whether the server is configured with SSL.- move "mysqldumpslow" from the client RPM to the server RPM (bug#20216)

- Revert all previous attempts to call "mysql_upgrade" during RPM upgrade,
  there are some more aspects which need to be solved before this is possible.
  For now, just ensure the binary "mysql_upgrade" is delivered and installysql.com>

- To run "mysql_upgrade", we need a running server;
  start it in isolation and skip password checks.- Always compile for PIC, position independent code.- Use character set "all" when compiling with Cluster, to make Cluster
  nodes independent on the character set directory, and the problem
  that two RPM sub packages both wants to install this directory.- Use "./libtool --mode=execute" instead of searching for the
  executable in current directory and ".libs".- Install and run "mysql_upgrade"- Remove sql-bench, and MySQL-bench RPM (will be built as an independent
  project from the mysql-bench repository)- Remove old mysqltestmanager and related programs- Set $LDFLAGS from $MYSQL_BUILD_LDFLAGS- Changed product name from "Community Edition" to "Community Server"- Fast mutexes is now disabled by default, but should be
  used in Linux builds.- Reintroduced a max build
- Limited testing of 'debug' and 'max' servers
- Berkeley DB only in 'max'- Use "-i" on "make test-force";
  this is essential for later evaluation of this log file.- Pass '-static' to libtool, link static with our own libraries, dynamic
  with system libraries.  Link with the bundled zlib.- Modified RPM spec to match new 5.1 debug+max combined community packaging.- Added "client/mysqlslap"- Added zlib to the list of (static) libraries installed
- Added check against libtool wierdness (WRT: sql/mysqld || sql/.libs/mysqld)
- Compile MySQL with bundled zlib
- Fixed %packager name to "MySQL Production Engineering Team"- Avoid using the "bundled" zlib on "shared" builds:
  As it is not installed (on the build system), this gives dependency
  problems with "libtool" causing the build to fail.
  (Change was done on Nov 11, but left uncommented.)- Extend the file existence check for "init.d/mysql" on un-install
  to also guard the call to "insserv"/"chkconfig".- added more man pages- Made yaSSL support an option (off by default)- Enabled yaSSL support- Give mode arguments the same way in all places
lenz@mysql.com>

- fixed the removing of the RPM_BUILD_ROOT in the %clean section (the
  $RBR variable did not get expanded, thus leaving old build roots behind)- Fixed the creation of the mysql user group account in the postinstall
  section (BUG 12348)
- Fixed enabling the Archive storage engine in the Max binary- Fixed the Requires: tag for the server RPM (BUG 12233)- create a "mysql" user group and assign the mysql user account to that group
  in the server postinstall section. (BUG 10984)- Do not build statically on i386 by default, only when adding either "--with
  static" or "--define '_with_static 1'" to the RPM build options. Static
  linking really only makes sense when linking against the specially patched
  glibc 2.2.5.- added mysql_client_test to the "bench" subpackage (BUG 10676)
- added the libndbclient static and shared libraries (BUG 10676)- use "mysqldatadir" variable instead of hard-coding the path multiple times
- use the "mysqld_user" variable on all occasions a user name is referenced
- removed (incomplete) Brazilian translations
- removed redundant release tags from the subpackage descriptions- Added a "make clean" between separate calls to "BuildMySQL".- Removed the mysql_tableinfo script made obsolete by the information schema- Enabled the "blackhole" storage engine for the Max RPM- removed the MySQL manual files (html/ps/texi) - they have been removed
  from the MySQL sources and are now available seperately.- old mysqlmanager, mysq* Mon Feb 7 2005 Tomas Ulin <tomas@mysql.com>

- enabled the "Ndbcluster" storage engine for the max binary
- added extra make install in ndb su�x�������������������X@
me�?p- ����������	5hare�$����������������
555
�RRRR4R8R<R#R&ROR@R-R(RRWR)R$R5RJRGRLRARKRFRRRRRRR4ROR8R<R#R&R-R@R(RRWR)RAR$R5RRRRR4ROR8R<R#R&R-R@R(RRWR)R'RARFR?R=R5R$RRRRRR4ROR8R<R#R&R-R@R(RRWR)R$R5RJRARGRLRKRFRRRRR4R8R<R#R&ROR@R-R(RRWR5RRRRR4R8R<R#R&ROR@R-R(RRWR)R'R?R=RJRGRLRARKRFR$R5R6RRRRRR4ROR8R<R#R&R-R@R(RRWRRR)RAR$R5RRRRR4R8R<R#R&ROR@R-R(RRWRRR9R5RRRRR4ROR8R@R-R(RRWR)RFRAR$R5RRRRR4R8R<R#R&ROR@R-R(RRWR)RAR$R5RRRRR4R8R<R#R&ROR@R-R(RRWRFRRR4ROR@R-R(RRWR5RRRR4RRWR6R5RRRRR4RRWRRR4RRWR3RRRRR4R2RRWR3RRRRR4R2RRWRRR4RRWR)RRRRRARLRKRFR4R;R@R-R(RRWR)R6R5RRRRFRAR4R@R-R(RRWR)R5RRRRRKRGRIRARCRFR4R@R-R(RRWRRR4RRWRRRR6R5R4RRWRRR4RRWR3RRRRR4R2RRWR3RRRRR4R2RRWRRR4RRWR)RRRRKRARFR4R;R@R-R(RRWR)R6R5RRRRARFR4R@R-R(RRWR)R5RRRRIRARCRKRFR4R@R-R(RRWR'R9RRRRR5R6R4ROR8R<R#R&R-R@R(RRWR+R)RNR6R5RRRRR?R=R$RHRARFRJRKR4R<R#R&RMR@R-R(RRWR)RFRARRR4R@R-R(RRWR)RARFRRRRR5R4R@R-R(RRWR)RRRR5RJRARKRFR4R@R-R(RRWR)R5RRRRARFR4R@R-R(RRWR)RRRR5RJRLRBRARKRHRFR4R%R@R-R(RRWRRR4R@R-R(RRWRRR4R@R-R(RRWR.RRRRRRRR RRRR5R6R4R@R-R(RRWRRR4R@R-R(RRWR)RR5R.RRRRJRDRGRERLRARKRFR4R@R-R(RR
RWRR4R@R-R(RRWRRR4RRWRR4RRWR)RRRRRRRR RRRRJRARKRHRFR5R6R4R@R-R(RRWRFRRRR4R@R-R(RRWRR4R@R-R(RRWR)R5RRRRJRARFR4R@R-R(RRWRRRR4RRWR)RRR6R5RARFR4R@R-R(RRWR5RRRR4R@R-R(RRWR)R5RARFRRRR4R@R-R(RRWR)R5RRRRJRARKRFR4R@R-R(RRWR)RARFRKR5RRRR4R@R-R(RRWR'RRR4ROR8R<R#R&R-R@R(RRWR)R+RNR?R=R$RRRRRRJRGRARLRKRHRFR5R6R4R<R#R&RMR@R-R(RRWR)RFRARRR4R@R-R(RRWR)RARFRRRRRR5R4R@R-R(RRWR)RRRR5RJRLRARKRFR4R@R-R(RRWR)R5RRRRRARFR4R@R-R(RRWR)RRRR5RJRGRBRLRARKRHRFR4R%R@R-R(RRWRRR4R@R-R(RRWRRR4R@R-R(RRWR.RRRRRRRR RRRRRR5R6R4R@R-R(RRWRRR4R@R-R(RRWR)RR5R.RRRRRJRDRGRERLRARKRFR4R@R-R(RR
RWRR4R@R-R(RRWRRR4RRWRR4RRWR)RRRRRRRRR RRRRRJRLRARKRHRFR5R6R4R@R-R(RRWRFRRR4R@R-R(RRWRRR4R@R-R(RRWR)R5RRRRJRARFR4R@R-R(RRWR5RRRR4RRWR)RRRR�x�������������p������XA
�?�H�0m�
�$-����������������
���
�er.so.0, introduced versioning.- If helper execution fails, try saved group ID.- New function: utempter_set_helper.- iface.c: block SIGCHLD instead of redefine signal handler.- utempter.h: do not use "__attribute ((unused))".- Added compatibility declarations to ease upgrade of old applications.
- Added small README file.
- Corrected provides.- Added compatibility library to ease upgrade of old applications.- Indented code a bit (Solar request).- Rewritten the code completely.
- Renamed to libutempter.
- Corrected the package description.
- FHSificated (yes, there are no more {_sbindir}/utempter).
- Libificated.- {_libdir}/utempter sounds better so use it as helper directory.- Specfile cleanup.
- Owl-compatible changes:
  + added utempter group;
  + utempter binary moved to {_libdir}/utempter.d,
    owned by group utempter with 710 permissions.- new version- build for RE- BM- add -devel
- add soname
- spec helper cleanup- changed group- 0.5.1
- fix utmp as group 22.
- strip utempter.
- defattr to root.- Mandrake adaptions- ignore SIGCHLD while processing utmp./bin/sh













	

��1.1.6-14.el81.1.6-14.el80.5.2

	
.build-id74d1ffc5dcbb7abb02c56454bc4e2bbff4e3268bffd4fe48b074a754fca1f347848796e698e1d8edlibutempter.so.0libutempter.so.1.1.6utempterutempterlibutempterREADMElibutempterCOPYING/usr/lib//usr/lib/.build-id//usr/lib/.build-id/74//usr/lib/.build-id/ff//usr/lib64//usr/libexec//usr/libexec/utempter//usr/share/doc//usr/share/doc/libutempter//usr/share/licenses//usr/share/licenses/libutempter/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu


directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=74d1ffc5dcbb7abb02c56454bc4e2bbff4e3268b, strippedsetgid ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ffd4fe48b074a754fca1f347848796e698e1d8ed, strippedASCII textPPRRR
RRRR
Rutf-84c4faef98d04d3da5f397288d344c0a9c456854f34d58dc9e8648e59bae444d1?��� i�3
!pQ�p�)�Tξ7��]�mtZ``s��
	�]�mtZ`�Z�?~AH�&J�B)ڟ`��L���-�o�-(�0E�q�xmo���d+Į	#��	��Z�<�]Y�nϢs�2̅��<do�~K+p��/�B ����A����6�[�ժ0�#�f�k$�H�o4��F�fhX�w���ya���
�GՅ�F��߫�Bj5��.��M�P���ʍ��]���Ͼ-HX�ԃ�>ÚԘ���ny���iVc2�Lc�
��5V��A����n@��'�� ��G��U	c�ӏr: N�

�P�!����� <�S8���5�T4�f{,	|���{�t���P ��;���c����ʆ�"ipe�$�������r��D�WB��(���h���5�$t2�z��F<=����
0W��^Ν��b��ܗ��=�JD���v��5�f�]B�l��|/tб�$���&��JԴ1�S��/�K�5���T�����T��g�g�m�D��D��U}f,^��l�I�� ��4�-)���:K�4�]Rh��r�6^xCs��3
!pQ�p�)�Tξ7��]�mtZ``s��
	�]�mtZ`k9�i>o�\��ؖ��5�]�T�M&�����2���r�=|��q]r��;�xH~-��d]�0o�L�>����rJ+I�^�^P28�(r�'@=)�l��]K��8���UNO�ɸ�T[0��ܫ��
��t�i2J��,%-)��lB�
�>a��8����m՞A�r̖f3��qp��F��|=�s����S�ަ�1�J#�+c��=c}��R�Q�Ҏ� ��sҹM��V�;�y|��f�9q,ujO�\�3��:4��S9�3>���K��N�벙RSR����:<#��ș��)X��g� C���hu$���r���!?���[���'Q�B�nmǬJ[/1����ih.���	��^iK�>�1�KDG�ZlMVy�sw���[�����!R�;�����	ąv��#U�V�ǕR��/��~
5��1��G�//?Y���'�F���(��;eȞ(N=��|h׽7|�L�\8T�E�5�%�5�ꅣ׶�t:ca6e909e7981ae87cc095ce2d36b5809096cc94afe685550d68baaffa0f142f834396399e36b92e82�x���������������������XB
���?��������������������_(gnu�$����������������
�_�_�_
�ri Popelka <jpopelka@redhat.com> - 12:4.2.5-28Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-27Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-26Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-25Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-24Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-23Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-22Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-21Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-20Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-19Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-18Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-17Tomas Hozza <thozza@redhat.com> - 12:4.2.5-16Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-15Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-14Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-13Adam Williamson <awilliam@redhat.com> - 12:4.2.5-12Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-11Adam Tkac <atkac redhat com> - 12:4.2.5-10Tomas Hozza <thozza@redhat.com> - 12:4.2.5-9Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-8Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 12:4.2.5-6Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-5Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-4Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-3Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-0.3.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-0.2.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.5-0.1.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-23.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-22.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-21.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-20.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-19.P2Adam Tkac <atkac redhat com> - 12:4.2.4-18.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-17.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-16.P2Tomas Hozza <thozza@redhat.com> - 12:4.2.4-15.P2Tomas Hozza <thozza@redhat.com> - 12:4.2.4-14.P1Tomas Hozza <thozza@redhat.com> - 12:4.2.4-13.P1Tomas Hozza <thozza@redhat.com> - 12:4.2.4-12.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-11.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-10.P1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 12:4.2.4-9.P1Tomas Hozza <thozza@redhat.com> - 12:4.2.4-8.P1Tomas Hozza <thozza@redhat.com> - 12:4.2.4-7.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-6Tomas Hozza <thozza@redhat.com> - 12:4.2.4-5Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-4Tomas Hozza <thozza@redhat.com> - 12:4.2.4-3Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-0.8.rc2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-0.7.rc2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-0.6.rc2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-0.5.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-0.4.rc1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-0.3.b1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-0.2.b1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.4-0.1.b1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-25.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-24.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-23.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-22.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-21.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-20.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-19.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-18.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-17.P2Adam Williamson <awilliam@redhat.com> - 12:4.2.3-16.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-15.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-14.P2Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-13.P2Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 12:4.2.3-12.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-11.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-10.P1Jiri Popelka <jpopelka@redhat.com> - 12:4.2.3-9.P1Jiri Popelka <jpopelka@r�x�������������`�������XC
.2�?pdat��������0:
�date�$����������������
���
� names
- add 'sed' to the buildprereq list (#24666)- added "exit 0" to the end of the pre script- self-hosting fix from Guy Streeter- use gcc for LD_L to pull in intrinsic stuff on ia64- take another whack at compatibility with "hash,age" data in pam_unix (#21603)- make the -devel subpackage unconditional- merge/update to 0.73- refresh from CVS -- some weird stuff crept into pam_unix- fix handling of "nis" when changing passwords by adding the checks for the
  data source to the password-updating module in pam_unix
- add the original copyright for pam_access (fix from Michael Gerdts)- redo similar() using a distance algorithm and drop the default dif_ok to 5
- readd -devel- fix similar() function in pam_cracklib (#14740)
- fix example in access.conf (#21467)
- add conditional compilation for building for 6.2 (for pam_userdb)
- tweak post to not use USESHADOW any more- make EINVAL setting lock limits in pam_limits non-fatal, because it's a 2.4ism- revert to DB 3.1, which is what we were supposed to be using from the get-go- add RLIMIT_LOCKS to pam_limits (patch from Jes Sorensen) (#20542)
- link pam_userdb to Berkeley DB 2.x to match 6.2's setup correctly- remove prereq on sh-utils, test ([) is built in to bash- fix the pam_userdb module breaking- fix pam_unix likeauth argument for authenticate(),setcred(),setcred()- tweak pre script to be called in all upgrade cases
- get pam_unix to only care about the significant pieces of passwords it checks
- add /usr/include/db1/db.h as a build prereq to pull in the right include
  files, no matter whether they're in glibc-devel or db1-devel
- pam_userdb.c: include db1/db.h instead of db.h- add BuildPrereq for bison (suggested by Bryan Stillwell)- patch from Dmitry V. Levin to have pam_stack propagate the PAM fail_delay
- roll back the README for pam_xauth to actually be the right one
- tweak pam_stack to use the parent's service name when calling the substack- create /etc/sysconfig/authconfig at install-time if upgrading- modify the files list to make sure #16456 stays fixed
- make pam_stack track PAM_AUTHTOK and PAM_OLDAUTHTOK items
- add pam_chroot module
- self-hosting fixes from the -devel split
- update generated docs in the tree- split off a -devel subpackage
- install the developer man pages- build libraries before modules- fix problems when looking for headers in /usr/include (#17236)
- clean up a couple of compile warnings- give users /dev/cdrom* instead of /dev/cdrom in console.perms (#16768)
- add nvidia control files to console.perms- add DRI devices to console.perms (#16731)- move pam_filter modules to /lib/security/pam_filter (#16111)
- add pam_tally's application to allow counts to be reset (#16456)
- move README files to the txts subdirectory- add a postun that runs ldconfig
- clean up logging in pam_xauth- make the tarball include the release number in its name- add a broken_shadow option to pam_unix
- add all module README files to the documentation list (#16456)- fix pam_stack debug and losing-track-of-the-result bug- rework pam_console's usage of syslog to actually be sane (#14646)- take the LOG_ERR flag off of some of pam_console's new messages- add pam_localuser- need to make pam_console's checking a little stronger
- only pass data up from pam_stack if the parent didn't already define it- automatic rebuild- make pam_console's extra checks disableable
- simplify extra check to just check if the device owner is root
- add a debug log when pam_stack comes across a NULL item
- have pam_stack hand items up to the parent from the child- fix installation of pam_xauth man pages (#12417)
- forcibly strip helpers (#12430)
- try to make pam_console a little more discriminating- symlink libpam.so to libpam.so.%{version}, and likewise for libpam_misc
- reverse order of checks in _unix_getpwnam for pam_unix- include gpmctl in pam_console- add MANDIR definition and use it when installing man pages- handle scanner and cdwriter devices in pam_console- add account management wrappers for pam_listfile, pam_nol�x�������������ز�������XD
pe�?e.,
D�}H�me =�$X����������������
H�I�
�J�l?�hd
�
�
�"
�	+
�	C
��
��
�
 
�
$
�
1
�
�
�	
�
�
�(
�.
8'�'	"'
p''	s'

�'d'''�

'
�(�("(dt�(�
8��9��:4��F�
G�<'H��'I�t'X��Y��\��']�t'^�Hb��
d�0
e�5
f�8
l�:
t�T'u��'v��w��'x��'y� ���
��
��"
��d


�x

�|
��
��

��

��
��4

�8'�`
g�d
h�h
CPercona-Server-client-575.7.3235.1.el8Percona Server - ClientThis package contains the standard Percona Server client and administration tools.

For a description of Percona Server see http://www.percona.com/software/percona-server/_���minimal-centos-8-x64-2265.ci.percona.comVN)Percona, IncCopyright (c) 2000, 2015, Oracle and/or its affiliates. All rights reserved. Under the GNU General Public License (http://www.gnu.org/licenses/).Percona MySQL Development Team <mysqldev@percona.com>Applications/Databaseshttp://www.percona.com/linuxx86_64;�87W�9��?!:gH;*89� D�9�:&'
a[�c�DFC�-�Y�����������A�����A�A�A�A���A�A�A큤��������������������_��~_��}_��~_��~_��}_��~_��}_��}_��~_��~_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|16654415b7273d47f72d5a2e60bddf59d26f0279d021b6b06e7185f389c6bfc0d6c83313f1208a763d0cb37fed6d95c05816f08881a0b36c7ec749b024efdfde777d3155bbf26069c22d0fe730cd8dcb2ef2b6c65c4d7f4595e887158a9cd6d1d3b8db6c8654b283df9bfd1a4e0e8204701940bcf53026c511c1fb8109ee2375db33d76dbf4486cbba0e2b54eee61b0451a974f67bcd35b23cf07b8c69144b4ae92e6b7c66684579f69dfd4009de34211dd50a9d1f868ff0dcab2eecdc9f6b05597bd4728c8fc08279276784c656a041997a409e2ffa1621f89d876cae16a9ca5bba1908a8ec994e0daff533fe5cadb063de917665a27d4b2a29cea775e6f5a331e85fd46960e2c7cc27aedd9f12af087462ce8677ac81a2587ce2919427512704f7b21420a0dcebce13e57827a72941c6dddf324af0502c1e426477b3c634fa600090ca8703ac1531d1224f0afdaadb0eacb7ef98f4f2f9cacd45318d1bb080cc39fdfcc7a218ce7c6b4d56e9d5f7865a19db8062076b1405c32b2f9e1c5e79f8d31ff515bedd38e3da586e6cdc59d5ac7ca1045ebd706bb9f848d12ddb78844792978cb58ec98076dd961d680bd7c8e92159df184714a7efa98c009022e7f29acb8a5a51403ec00c7542d92d9300bff991f80221d14de6b576349ec9080e0234f7a2e26fe2e46ce1d71889fe92a251b10d06d1e473d1f5c943f53373ea0885573047a203197166bea5eb1b6f843cd47792d06ec7648921c7c956472db30eeb0db86de9754ffb63a0e0ee5886c9302b42d517cfb5bdd2dbf0c4ff294729f469edeb55b4f33c9c741af8827869d19a6b8ad7f10d69fef4b68e50070cc6ed20ba79da77fcf149cf0df47fadfe4a8aeb6ddfc619a44dcd6660327b5d186ea90da5efb01e162edfc079d0e7ad180844cf54201f1e3bcf7c494a38d3dfe99dd96f06../../../../usr/bin/mysql../../../../usr/bin/mysqlimport../../../../usr/bin/mysqlcheck../../../../usr/bin/mysqlshow../../../../usr/bin/mysql_config_editor../../../../usr/bin/mysqlbinlog../../../../usr/bin/mysqldump../../../../usr/bin/mysqlpump../../../../usr/bin/mysqladmin../../../../usr/bin/mysqlslap�x�������������P��������XE
k t? not�@������8u\Eand �$L����������������
\E]EPN
�den)
- sealert -l message in syslog converts from html before writing to syslog
- Resolve bug 320881: export setroubleshoot_selinux_symposium in PDF format
- add code to verify all async rpc's have been cleared from the async rpc cache
- add code to set a default rpc method return if the interface does not define a callbak
  (methods which did not have a callback were not returning anything and hence were no
   getting cleared from the cache)- Resolve bug 428252: Problem with update/remove old version
- Add code to validate xml database version, if file is incompatible it is not read,
   the next time the database is written it will be in the new version format.
   This means the database contents are not preserved across database version upgrades.
- Remove postun trigger from spec file used to clear database between incompatible versions
   the new database version check during database read will handle this instead
- bullet proof exit status in init script and rpm scriptlets
- Resolve bug 247302: setroubleshoot's autostart .desktop file fails to start under a KDE session
- Resolve bug 376041: Cannot check setroubleshoot service status as non-root
- Resolve bug 332281: remove obsolete translation
- Resolve bug 344331: No description in gnome-session-properties
- Resolve bug 358581: missing libuser-python dependency
- Resolve bug 426586: Renaming translation po file from sr@Latn to sr@latin
- Resolve bug 427260: German Translation
- enhance the sealert man page- make connection error message persist instead of timeout in browser
- updated Brazilian Portuguese translation: Igor Pires Soares <igor@fedoraproject.org>
- implement uid,username checks
- rpc methods now check for authenticated state
- fix html handling of summary string
- add 'named' messages to status bar, make sure all messages either timeout or are named
- fix ordering of menus, resolves bug 427418
- add 'hide quiet' to browser view filtering, resolves bug 427421
- tweak siginfo text formatting
- add logon to SECommandLine so that sealert -l <local_id> works- prepare for v2 test release
- Completed most work for version 2 of setroubleshoot, prepare for test release
- import Dan's changes from the mainline
   primarily allow_postfix_local_write_mail_spool plugin
- escape html, fix siginfo.format_html(), siginfo.format_text()
- add async-error signal
- change identity to just username
- make sure set_filter user validation works and reports error in browser
- fix generation of line numbers and host when connected to audispd
- add permissive notification, resolves bug 231334: Wording doesn't change for permissive mode
- resolves bug 244345: avc path information incomplete
- get the uid,gid when a client connects to the server
- set_filter now verifies the filter is owned by the user,
- resolves bug 288261: setroubleshoot lack of user authentication
- remove filter options which weren't being used
- change '@' in audit data hostname to '.'
- remove restart dialog
   resolves bug 321171: sealert's dialog after update is higly confusing
- fix rpc xml arg
- fix handling of host value
- tweak what fields are in signature
- move data items which had been in 'avc' object into siginfo
- clean up siginfo format
- large parts of new audit data pipeline working, checkpoint
- fix duplicate xml nodes when generating xml tree
- audit event can now be xml serialized
- switch from using int's for audit record types to strings
- avoid conversion headaches and possibilty of not being
   able to convert a new unknown type
- add logic to allow XmlSerialize to be subclassed and init_from_xml_node to be overridden
- add support to xml serialize classes AuditEventID, AuditEvent, AuditRecord
- use metaclass for xml class init
- start adding xml support to audit data classes
- Use metaclass to wrap class init
- move xml serialization code from signature.py to xml_serialize.py
- simplify aspect of the serialization code
- add unstructured xml mapping, each xml element name has its content mapped to obj.name
- modify xml serialization to be driven by xml cont�x�������������ȑ�������XF
 a�?st d�����������������4og f�$a����������������
�4�4�4
�../../../../usr/lib64/mysql/plugin/debug/version_token.so../../../../usr/lib64/mysql/plugin/keyring_file.so../../../../usr/lib64/mysql/plugin/debug/data_masking.so../../../../usr/lib64/mysql/plugin/adt_null.so../../../../usr/lib64/mysql/plugin/rewriter.so../../../../usr/bin/mysql_ssl_rsa_setup../../../../usr/lib64/mysql/plugin/auth_socket.so../../../../usr/bin/replace../../../../usr/lib64/mysql/plugin/debug/ha_example.so../../../../usr/lib64/mysql/plugin/debug/scalability_metrics.so../../../../usr/lib64/mysql/plugin/semisync_master.so../../../../usr/lib64/mysql/plugin/locking_service.so../../../../usr/lib64/mysql/plugin/debug/libmurmur_udf.so../../../../usr/lib64/mysql/plugin/debug/semisync_slave.so../../../../usr/lib64/mysql/plugin/libmurmur_udf.so../../../../usr/lib64/mysql/plugin/debug/semisync_master.so../../../../usr/bin/perror../../../../usr/lib64/mysql/plugin/debug/dialog.so../../../../usr/bin/myisam_ftdump../../../../usr/lib64/mysql/plugin/debug/group_replication.so../../../../usr/lib64/mysql/plugin/scalability_metrics.so../../../../usr/bin/resolveip../../../../usr/bin/myisamchk../../../../usr/lib64/mysql/plugin/mypluglib.so../../../../usr/lib64/mysql/plugin/debug/keyring_vault.so../../../../usr/lib64/mysql/plugin/auth_pam_compat.so../../../../usr/sbin/mysqld-debug../../../../usr/lib64/mysql/plugin/libpluginmecab.so../../../../usr/lib64/mysql/plugin/auth.so../../../../usr/lib64/mysql/plugin/audit_log.so../../../../usr/bin/zlib_decompress../../../../usr/bin/resolve_stack_dump../../../../usr/lib64/mysql/plugin/keyring_vault.so../../../../usr/lib64/mysql/plugin/version_token.so../../../../usr/lib64/mysql/plugin/debug/libmemcached.so../../../../usr/lib64/mysql/plugin/debug/udf_example.so../../../../usr/lib64/mysql/plugin/debug/auth.so../../../../usr/lib64/mysql/plugin/auth_pam.so../../../../usr/bin/innochecksum../../../../usr/lib64/mysql/plugin/query_response_time.so../../../../usr/bin/myisampack../../../../usr/lib64/mysql/plugin/authentication_ldap_sasl_client.so../../../../usr/bin/myisamlog../../../../usr/bin/mysql_tzinfo_to_sql../../../../usr/lib64/mysql/plugin/libfnv_udf.so../../../../usr/bin/my_print_defaults../../../../usr/lib64/mysql/plugin/debug/libpluginmecab.so../../../../usr/lib64/mysql/plugin/debug/connection_control.so../../../../usr/lib64/mysql/plugin/group_replication.so../../../../usr/lib64/mysql/plugin/debug/mysqlx.so../../../../usr/lib64/mysql/plugin/debug/mypluglib.so../../../../usr/lib64/mysql/plugin/debug/auth_socket.so../../../../usr/bin/mysql_upgrade../../../../usr/lib64/mysql/plugin/data_masking.so../../../../usr/lib64/mysql/plugin/debug/mysql_no_login.so../../../../usr/lib64/mysql/plugin/debug/rewriter.so../../../../usr/lib64/mysql/plugin/mysqlx.so../../../../usr/lib64/mysql/plugin/connection_control.so../../../../usr/lib64/mysql/plugin/debug/rewrite_example.so../../../../usr/lib64/mysql/plugin/debug/authentication_ldap_sasl_client.so../../../../usr/lib64/mysql/plugin/debug/innodb_engine.so../../../../usr/bin/mysql_secure_installation../../../../usr/lib64/mysql/plugin/semisync_slave.so../../../../usr/lib64/mysql/plugin/debug/libfnv_udf.so../../../../usr/lib64/mysql/plugin/rewrite_example.so../../../../usr/lib64/mysql/plugin/validate_password.so../../../../usr/bin/mysql_plugin../../../../usr/lib64/mysql/plugin/dialog.so../../../../usr/lib64/mysql/plugin/mysql_no_login.so../../../../usr/lib64/mysql/plugin/ha_example.so../../../../usr/lib64/mysql/plugin/debug/query_response_time.so../../../../usr/lib64/mysql/plugin/keyring_udf.so../../../../usr/lib64/mysql/plugin/libfnv1a_udf.so../../../../usr/lib64/mysql/plugin/debug/adt_null.so../../../../usr/lib64/mysql/plugin/innodb_engine.so../../../../usr/lib64/mysql/plugin/debug/auth_pam.so../../../../usr/lib64/mysql/plugin/debug/keyring_udf.so../../../../usr/lib64/mysql/plugin/debug/validate_password.so../../../../usr/lib64/mysql/plugin/udf_example.so../../../../u�x�������������0��������XG
e �?with��������0���������ahya�$����������������
��$
N
���������������xsgbVQE@4/#

���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#





�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
����� CONFIG_IEEE802154_AT86RF230=m, CONFIG_IEEE802154_MRF24J40=m,
- CONFIG_IEEE802154_CC2520=m, CONFIG_IEEE802154_ATUSB=m,
- CONFIG_IEEE802154_ADF7242=m, CONFIG_IEEE802154_CA8210=m,
- CONFIG_IEEE802154_MCR20A=m and CONFIG_IEEE802154_HWSIM=m
- [http://lists.elrepo.org/pipermail/elrepo/2020-September/005375.html]- Updated with the 5.8.6 source tarball.
- [https://www.kernel.org/pub/linux/kernel/v5.x/ChangeLog-5.8.6]- Updated with the 5.8.5 source tarball.
- [https://www.kernel.org/pub/linux/kernel/v5.x/ChangeLog-5.8.5]- Updated with the 5.8.4 source tarball.
- [https://www.kernel.org/pub/linux/kernel/v5.x/ChangeLog-5.8.4]- Updated with the 5.8.3 source tarball.
- [https://www.kernel.org/pub/linux/kernel/v5.x/ChangeLog-5.8.3]- Updated wit
eC
green_sardine_vcn.bin
d3
green_sardine_ta.bin3
cO
green_sardine_sdma.binFI� �)
�#
�� �)
�#
�� �)
�#
�� �)
�#
�� �)
�#
�� �)
�#
�� �)
�#
�� �)
�#
�]��`�d
�	���$R��

��$��&
�I���0�
�
�q�[�8

����Rx\

�ۋLp�1
�D�M��l
�Wl>"
�
���%.
�
����B��
�Jd���
�WlOk�
�
9�͞d�
��|�~��<
����o#$�
���^Cp=
�tg~�4lE
�K=7%
��g�*
�
�������
�t�k�4�
�O;����/

�
ۍ��_��
���8��

��$ً�+
�"^�I�L(
�R�=�

�K=�`I
�ۍ�^-
����a�x�
��$�
�
�����:8$
�K=�`�8
�ۋA��
�ۍ����
�i?�\�H
���Oi�ܖ
�
�/?��PH
��|ᗟ��
�ۍ��


�����:
��+�t|I
�Q���
�K=baT)
�'�VM��

��F����
��+��
�i��g�t
�K=�a�o
�'�i�l�

��$��ATM
�
�FQ��"
��+�t0D
��F����
��+{c�'
�p�L�l]
�ۋ�Vk
��S�I>ܧ

�l*���4
��+nqd"
��S�i���

�l*�pj�"
��+;
�
��$�
�"
��S��r�

�]��ĸ��

�	�$��:�
�
l*��j��
���/�d�
��+a
0-
��|���
��$�p:�)
�
D�b0�4
�"^�۶0t
����(�
��+�r�
�D��0�
~����Pv

}�q�?
�

|�|��>
xD�(1@J
v�q�}>
$b

tm�~���A

q�$�2($
l�Qד6pz
k��Ih

i�$�$&
d��\��+
a�%�~�P
_D����
^|B�r]xҨ
Z���$

YD�<�@�
Vl��<
U�q�&q�
T|B��
R|^�~
Q_[��4
@;
OD���(
NY�>PD
M|^���+
ID���4
FY��?܌
E|^�X�h#

A����a
=Y�<=�8
=0��t�N
;
G�0�
9��a�~
7D�T��
6�q��,$H
4G��&�+
1���$t
/D�4�<-
."^��d<a
.���sL�
-'�'�=�:
-�$����
,G���

)��e>
'D�n� .
&�q�ӯH

$Y�lX
!�>���dI
!oңY�
D�zY(
�q�c�

�$�g�>
Y�d	$

ۋ�H<a
���)��1
D��K8 
�q��cH�
�|��}

Y����

D����|
���e41

�q�;[�
���`�\�
	D�d�h!
�$��t,

���+�
K=�CTA
���RR��

�x��������������p�������XH
86k?d6e4Pr���������������12ee�$����������������
����dE
�inkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)setroubleshoot-pluginssystemd-python333.3.26-6.el82.1.5-13.63.113.0.4-14.6.0-14.0.4-14.0-15.2-13.3.10206-14.14.3chown -R setroubleshoot:setroubleshoot /var/lib/setroubleshootsetroubleshoot-server3.2.24-4d�F@co�bγ�b�bO�a�A@aQ�@`>�_��_3�^��@^��^
�@]��@]V��]/
�\ڭ�\�@\��\w�[���[O+�[;e@Z���Z�
�Z}�@Za�Za�ZOh�Z�@Z�Z �Y���Y�@Yy�Y?�X���XW�W��W�@W�!�Wi,@WP�WP�W<Y@W,�@W�@WK�WW@V�w�V�=@V��@VA�@U�Y�U�M@U�@U�@U�@U8�U&i�U�U�T��S��@S��S�D�S�P@Sy�@SF��S1o�S1o�R��R��@R�T�R�T�R��R��@R6�R/	�Q�M�Q�M�Q�M�Q��@Q�a�Q��Qq1�Qq1�Qq1�Qb�@QR�@QQ��Q#@Q#@Q
\�Qs�P��@P��@P�7@P�7@Pt�Pt�P[@P(�@P�P�P
��OЗ�O��@O�\@Od|�OX�@OX�@OX�@OX�@OOd�O:L�OK�OW@Ob�O�@N�m@N�Nܲ@N�@N��N��@NW��N?�N��N|@M۝�M�'�M��@Ml�MbS�M^_@M[�@MR��MR��M@�M=i�M5��M5��M'@M%��M9�M�@L��@L�L�L�@L�L�[@L�f�L��L�,@Lډ@K�!@K��K��@K�q�Kw�Kr��Kj��Kh�K^�@KY�@KV�@KU��KTM@KM��K�@K��K�K
>�J�U�J�@J��J��@J�@J��J��J�k�J��@Ĵ�J��Ję�J��@J���J�_@J��@J�;�J��@J��@J��J��@J��@J�u@J�#�J��J��J�:�J���J���J���J�@Jq�@Jm��JlE@Je��Jc
�J[!�JS8�JKO�JKO�JH��JD�@JB@J?r@J:,@J7�@J/�@J,�@J&e�JB@J
{�I��I�@I�@I�n@I��I�2�I�l@I�l@I�l@Iw@Ipv�I1.�H��@H׈�HǶ�H�e@H�e@H�e@G�g�G��@G��@G�Z@G~�Gt�@G2�F�I�F���F�F�F��F�v�F�v�Fn��F]g@F/B�E�{@E�@E݅�E՜�E՜�E�b@Eɿ@E�'�E�x@E�&�E��@E�%�E���E�@E�@Ez�@EyS�Et
�Ep@En�El$�Ee�@Eb�@EQ�EPu@E>@E4�E"P�E"P�E
�Eg�E@E@E�@E
��E	�D��@D��@D��@D�}�D��@D�D�D�D��D��D��D��D��D�@D�@D�@D�@D�N�D�Z@D��D�|�D�+@DԈ@D�@D�Y@D�@D���D���D���D�p@D��D��D��@D��@Dm�@Vit Mojzis <vmojzis@redhat.com> - 3.3.26-6Vit Mojzis <vmojzis@redhat.com> - 3.3.26-5Vit Mojzis <vmojzis@redhat.com> - 3.3.26-4Vit Mojzis <vmojzis@redhat.com> - 3.3.26-3Vit Mojzis <vmojzis@redhat.com> - 3.3.26-2Vit Mojzis <vmojzis@redhat.com> - 3.3.26-1Vit Mojzis <vmojzis@redhat.com> - 3.3.24-4Vit Mojzis <vmojzis@redhat.com> - 3.3.24-3Vit Mojzis <vmojzis@redhat.com> - 3.3.24-2Vit Mojzis <vmojzis@redhat.com> - 3.3.24-1Vit Mojzis <vmojzis@redhat.com> - 3.3.23-1Petr Lautrbach <plautrba@redhat.com> - 3.3.22-2Petr Lautrbach <plautrba@redhat.com> - 3.3.22-1Vit Mojzis <vmojzis@redhat.com> - 3.3.21-1Vit Mojzis <vmojzis@redhat.com> - 3.3.20-2Vit Mojzis <vmojzis@redhat.com> - 3.3.20-1Vit Mojzis <vmojzis@redhat.com> - 3.3.19-2Petr Lautrbach <plautrba@redhat.com> - 3.3.19-1Petr Lautrbach <plautrba@redhat.com> - 3.3.18-4Petr Lautrbach <plautrba@redhat.com> - 3.3.18-3.1Petr Lautrbach <plautrba@redhat.com> - 3.3.18-2Petr Lautrbach <plautrba@redhat.com> - 3.3.18-1Tomas Orsava <torsava@redhat.com> - 3.3.17-2Petr Lautrbach <plautrba@redhat.com> - 3.3.17-1Petr Lautrbach <plautrba@redhat.com> - 3.3.16-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 3.3.15-3Björn Esser <besser82@fedoraproject.org> - 3.3.15-2Petr Lautrbach <plautrba@redhat.com> - 3.3.15-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 3.3.14-4Petr Lautrbach <plautrba@redhat.com> - 3.3.14-3Petr Lautrbach <plautrba@redhat.com> - 3.3.14-2Petr Lautrbach <plautrba@redhat.com> - 3.3.14-1Petr Lautrbach <plautrba@redhat.com> - 3.3.13-1Fedora Release Engineering <releng@fedoraproject.org> - 3.3.12-3Fedora Release Engineering <releng@fedoraproject.org> - 3.3.12-2Petr Lautrbach <plautrba@redhat.com> - 3.3.12-1Fedora Release Engineering <releng@fedoraproject.org> - 3.3.11-3Miro Hrončok <mhroncok@redhat.com> - 3.3.11-2Petr Lautrbach <plautrba@redhat.com> - 3.3.11-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.3.10-2Petr Lautrbach <plautrba@redhat.com> - 3.3.10-1Petr Lautrbach <plautrba@redhat.com> - 3.3.9.1-1Petr Lautrbach <plautrba@redhat.com> - 3.3.8.1-1Petr Lautrbach <plautrba@redhat.com> - 3.3.8-1Petr Lautrbach <plautrba@redhat.com> - 3.3.7-1Petr Lautrbach <plautrba@redhat.com> - 3.3.6-1Petr Lautrbach <plautrba@redhat.com> - 3.3.5-3Petr Lautrbach <plautrba@redhat.com> - 3.3.5-2Petr Lautrbach <plautrba@redhat.com> - 3.3.5-1Petr Lautrbach <plautrba@redhat.com�x������������� `�������XI
 a�?ory "X��������4erro�$~����������������
�4�4�4
�2001dde3e9c76f2a1092089f1ddc8b268e6e9cf39b091db91c8849df87e51d0f4cafc2ae9a112e657f6bc588f76c6a160fab3d57c49e036da8f2b4cbc4b13d724d701ed7a5a893f0663e2b6faec54dcc36572962d626e0ff838e8c110ff8826c73a320693a17f7ae649b67c17edb8053af1fe9df00f81e2ff8db863f464d8752f477e59f84748767e8fe944273e4addbc23660568af89428b40f93fc91013212327991e20d20443d9694b0093480efb00718f02eb9c19e37c55053e641cc3587f29c2f4faa5440298a31b089937da3c45b104edbab2b3cd98638c14084e3e5224a9e1bf4aa5bff73fbaa16b31da5b5de0ab88f6cc2a9d20db3c99ed6cf73d761acb4fb0d2919f0ac9a15791ad4b41cd3ecca5cd16e415d6fd943ef9b5a97b422f68279eae677e7774ab44e2edf61c8a83d7ecc72ff6e2e49a2e7e86a9be97b7b0f4aed1054abd3a0a07222e8d7a1696126578dcf38ef84a0e9020365a3c87d56025baf8d99e29f7647c4c1517d58d044eadaa0315f69b7a7ecd838258f5d53b35e85cf8324bf55fd71d40ef7519ab1b1e7a975ed20c1ba1822c0dfaaa23e31656b0b28fd9970f0bb8522a358bd1362ba66a3717adce66086e07cc76de375f8a2d305a13efbafc6dd55ffea485d180b0f43352c36d974b34277cd61bbe42c6dce3ebdb40e7480bf9840f3731ee1a7f7642339f80d80882a383614bff8b66473593d1a1a5849c2773d2718ab6f359f677cd74252f2c3659c470ed6480c7713585b6b5968fdc98b3eefb25de61cdc9c439eb51a6a6e803f5c87e56f8102d0176141df275dbdc859f3373258e1e12370f73e8236152b2dcb47deb32df9a5aab15c8d657aac6bf9fa554217dc574a906e672fa12f6bcb7f948ece014434da5746e5d10a0d3f9b1053784815c100807ab7186e81e45a9a99bf7f8e98ba8dddea1eb0f46041fd09e8cdca4c26f70648667b9224b72b775684678bcc59e23d776f57aab20971c7503d21d79b630720a45e3aff477c6d5f646a0dec5543560bc22cd9041303a9c4308ce73334020cb55d8a1a360c8ebb02e2e40375da069f5f2e1e6d4c71e7c9498e34e50254fdf7b8861ccf9d9c5ae4c824909791faf6762172f22a9643b1a9436fe94744442e65a277143415a2be46086f662e90f675a1e1c83b8d36a51b0d1299b52b5341abb2a7be777ff117ea0c314d0531e7750721d26b40fda8c3e7029784195ad95381aa3f5603063ea3098c8139c284b9bdb731bf49cb2aca64cec641c4b6693da9b698f705fc4d812ea73f27a350377d25e9a6d7afc9bfac392d40f513ae83871eea0924b95a3314afdd01a4605f9216bc09b04b9acc5082732d0a43de598c8db6736f64bae51be06faef9da7a86d36b3c6b583b4db5910658a840f5abbad05f9e3a331bb74cdfbc173540152ba227365692b60bfea418b46e217d77bc2c8feabf6c1bb379a13033b5bbb8f8fea88e1c5203c3e6894b7924d9be06ec819654ca0c487d419f7298bf5d699000e2cfd6c4e417d130cfb32a5792ba4240176a07f378054d7b99990ad410386f85b63f9fbe76fb381abc24615fac23e8105f44bd4a9c4589ea4d0162a9c059d2f18ca373fe751acfb0607e4b7a014f8333fb6f7d00b800704241bc6fbdfb74944cc0e1ed979b5530b054e8edf3d0293c392cb875b496db095e2076498c8f975311e104f794a49392c2dd7ac0137408d3e32a679cc089cc98b4fc4d3c0ebc3221f5217f3d38c988b3f17bcdb5ec9ecdf9603fa34be77677bbc033a62bb872ae925ef82a1a4d8349a7b42fd919f47e68ae9642049d76340527c22e654c586a85c95fdde924d3cb78eb944f8f6a383e7b64d9b4ba779e4fd28ba83a936129f43470ba51e3ae3befd8553c6c30e20e2d096abf54d0f8dba4938fefdf99b9c24fae0a0565a2934a521efe16deaa31bb4bcd27d8c5250a2742b96e023b8fe7afd0a66ca7caf27f603cb8d325dd156d775b39812e9ddc85ac8a015fce226b097e5b734666eb8cdf5b3826c94601cd4cc9e58b064e46461050c9e5b24b8aac7b3531cb9a35d3bc56cdb332a02b1caded34a6b25ed66fe59c130b79829302e73744eb5a617d1b09ff70c6bf30e49f289667e0c33856678c1a6c0077d907472c90381c3b8428621ebece803a5d14c450f618170c2c7480205bd5480ebda9af0b990da26cea7296c14d81952845c45af4b26c70799baceb1ac3ec35bff5683dc23caa9e12674ab5d825923d81a3395236b0fb3e52c05efcf22be60fe6c85258f9a6890e97085ebbc6f21df073ec53aa7783fd2474efb87ccb28e0b3be0cab11576f0967ba1a773defe934c6149bc72e3fa6a9907648a7e2375283128a84ec238229dc46111403dd695c992a66a88a3861d85b57064f925292a275df15731cffaac043fbffe083beef538a246ceea53bf82aaa09c62e9dbc649296271248ec33d3b0db9b45c964cb9dd678cfdff6af3c2f97a4ea4c6ed6cf6210403ab9801bc5a3b1934b196676765382ea3f3b9e21bfa25837c080e925ffdb155e9c0fe509c0fd39359b61ccca1e6b39dbed91af3a87c8458f8d6225a465c95c7fdd6c754f5be460a77001787c3fa756490a569e5c32410d15ca93cf985519dcee08de5d0fced9d5a5c9f1e37599c5286cc88c95f2174653837e08188a3f19c1f3df62c1f9fe9df48ca82440d0214612365d9da0ed9b56baa7783ecf�x��������������O�������XJ
�?��������X���$K����������������
���
�hich could be
  significantly incorrect (#961221)- pull in upstream fix to start treating a KRB5CCNAME value that begins
  with DIR:: the same as it would a DIR: value with just one ccache file
  in it (RT#7172, #965574)- pull up fix for UDP ping-pong flaw in kpasswd service (CVE-2002-2443,- Update otp patches
- Merge otp patches into a single patch
- Add keycheck patch- pull the changing of the compiled-in default ccache location to
  DIR:/run/user/%{uid}/krb5cc back into F19, in line with SSSD and
  the most recent pam_krb5 build- correct some configuration file paths which the KDC_DIR patch missed- update to 1.11.2
  - drop pulled in patch for RT#7586, included in this release
  - drop pulled in patch for RT#7592, included in this release
- pull in fix for keeping track of the message type when parsing FAST requests
  in the KDC (RT#7605, #951843) (also #951965)- move the compiled-in default ccache location from the previous default of
  FILE:/tmp/krb5cc_%{uid} to DIR:/run/user/%{uid}/krb5cc (part of #949588)- Update otp backport patches (libk5radius => libkrad)- when testing the RPC library, treat denials from the local portmapper the
  same as a portmapper-not-running situation, to allow other library tests
  to be run while building the package- create and own /var/kerberos/krb5/user instead of /var/kerberos/kdc/user,
  since that's what the libraries actually look for
- add buildrequires on nss-myhostname, in an attempt to get more of the tests
  to run properly during builds
- pull in Simo's patch to recognize "client_keytab" as a key type which can
  be passed in to gss_acquire_cred_from() (RT#7598)- pull up Simo's patch to mark the correct mechanism on imported GSSAPI
  contexts (RT#7592)
- go back to using reconf to run autoconf and autoheader (part of #925640)
- add temporary patch to use newer config.guess/config.sub (more of #925640)- fix a version comparison to expect newer texlive build requirements when
  %{_rhel} > 6 rather than when it's > 7- Add libverto-devel requires for krb5-devel
- Add otp support- fix a memory leak when acquiring credentials using a keytab (RT#7586, #911110)- prebuild PDF docs to reduce multilib differences (internal tooling, #884065)
- drop the kerberos-iv portreserve file, and drop the rest on systemd systems
- escape uses of macros in comments (more of #884065)- update to 1.11.1
  - drop patch for noticing negative timeouts being passed to the poll()
    wrapper in the client transmit functions- set "rdns = false" in the default krb5.conf (#908323,#908324)- update to 1.11 release- update to 1.11 beta 2- when building with our bundled copy of libverto, package it in with -libs
  rather than with -server (#886049)- update to 1.11 beta 1- handle releases where texlive packaging wasn't yet as complicated as it
  is in Fedora 18
- fix an uninitialized-variable error building one of the test programs- move the rather large pile of html and pdf docs to -workstation, so
  that just having something that links to the libraries won't drag
  them onto a system, and we avoid having to sort out hard-coded paths
  that include %{_libdir} showing up in docs in multilib packages
- actually create %{_var}/kerberos/kdc/user, so that it can be packaged
- correct the list of packaged man pages
- don't dummy up required tex stylesheets, require them
- require pdflatex and makeindex- update to 1.11 alpha 1
  - drop backported patch for RT #7406
  - drop backported patch for RT #7407
  - drop backported patch for RT #7408
  - the new docs system generates PDFs, so stop including them as sources
  - drop backported patch to allow deltat.y to build with the usual
    warning flags and the current gcc
  - drop backported fix for disabling use of a replay cache when verifying
    initial credentials
  - drop backported fix for teaching PKINIT clients which trust the KDC's
    certificate directly to verify signed-data messages that are signed with
    the KDC's certificate, when the blobs don't include a copy of the KDC's
    certificate
  - drop backpor�x�������������?�������XK
x �	?0, B��������xN������8558b2�$(����������������
857595
�init__.pycollections_abc.pyproviders.pyreporters.pyresolvers.pystructs.pysix.pytenacity__init__.py_asyncio.py_utils.pyafter.pybefore.pybefore_sleep.pynap.pyretry.pystop.pytornadoweb.pywait.pytomli__init__.py_parser.py_re.pyurllib3__init__.py_collections.py_version.pyconnection.pyconnectionpool.pycontrib__init__.py_appengine_environ.py_securetransport__init__.pybindings.pylow_level.pyappengine.pyntlmpool.pypyopenssl.pysecuretransport.pysocks.pyexceptions.pyfields.pyfilepost.pypackages__init__.pybackports__init__.pymakefile.pysix.pyssl_match_hostname__init__.py_implementation.pypoolmanager.pyrequest.pyresponse.pyutil__init__.pyconnection.pyproxy.pyqueue.pyrequest.pyresponse.pyretry.pyssl_.pyssltransport.pytimeout.pyurl.pywait.pyvendor.txtwebencodings__init__.pylabels.pymklabels.pytests.pyx_user_defined.pypy.typedpkg_resources__init__.py_vendor__init__.pyappdirs.pypackaging__about__.py__init__.py_manylinux.py_musllinux.py_structures.pymarkers.pyrequirements.pyspecifiers.pytags.pyutils.pyversion.pypyparsing.pyextern__init__.pytestsdatamy-test-package-sourcesetup.pypyOpenSSL-23.2.0.dist-infoINSTALLERLICENSEMETADATARECORDREQUESTEDWHEELtop_level.txtpycparserpycparser-2.21.dist-infoINSTALLERLICENSEMETADATARECORDWHEELtop_level.txt__init__.py_ast_gen.py_build_tables.py_c_ast.cfgast_transforms.pyc_ast.pyc_generator.pyc_lexer.pyc_parser.pylextab.pyply__init__.pycpp.pyctokens.pylex.pyyacc.pyygen.pyplyparser.pyyacctab.pypymysql__init__.py_auth.pycharset.pyconnections.pyconstantsCLIENT.pyCOMMAND.pyCR.pyER.pyFIELD_TYPE.pyFLAG.pySERVER_STATUS.py__init__.pyconverters.pycursors.pyerr.pyoptionfile.pyprotocol.pytimes.pysetuptoolssetuptools-59.6.0.dist-infoINSTALLERLICENSEMETADATARECORDWHEELentry_points.txttop_level.txtsetuptools-59.6.0.virtualenv__init__.py_deprecation_warning.py_distutils__init__.py_msvccompiler.pyarchive_util.pybcppcompiler.pyccompiler.pycmd.pycommand__init__.pybdist.pybdist_dumb.pybdist_msi.pybdist_rpm.pybdist_wininst.pybuild.pybuild_clib.pybuild_ext.pybuild_py.pybuild_scripts.pycheck.pyclean.pyconfig.pyinstall.pyinstall_data.pyinstall_egg_info.pyinstall_headers.pyinstall_lib.pyinstall_scripts.pypy37compat.pyregister.pysdist.pyupload.pyconfig.pycore.pycygwinccompiler.pydebug.pydep_util.pydir_util.pydist.pyerrors.pyextension.pyfancy_getopt.pyfile_util.pyfilelist.pylog.pymsvc9compiler.pymsvccompiler.pypy35compat.pypy38compat.pyspawn.pysysconfig.pytext_file.pyunixccompiler.pyutil.pyversion.pyversionpredicate.py_imp.py_vendor__init__.pymore_itertools__init__.pymore.pyrecipes.pyordered_set.pypackaging__about__.py__init__.py_manylinux.py_musllinux.py_structures.pymarkers.pyrequirements.pyspecifiers.pytags.pyutils.pyversion.pypyparsing.pyarchive_util.pybuild_meta.pycli-32.execli-64.execli-arm64.execli.execommand__init__.pyalias.pybdist_egg.pybdist_rpm.pybuild_clib.pybuild_ext.pybuild_py.pydevelop.pydist_info.pyeasy_install.pyegg_info.pyinstall.pyinstall_egg_info.pyinstall_lib.pyinstall_scripts.pylauncher manifest.xmlpy36compat.pyregister.pyrotate.pysaveopts.pysdist.pysetopt.pytest.pyupload.pyupload_docs.pyconfig.pydep_util.pydepends.pydist.pyerrors.pyextension.pyextern__init__.pyglob.pygui-32.exegui-64.exegui-arm64.exegui.exeinstaller.pylaunch.pymonkey.pymsvc.pynamespaces.pypackage_index.pypy34compat.pysandbox.pyscript (dev).tmplscript.tmplunicode_utils.pyversion.pywheel.pywindows_support.pywheelwheel-0.37.1.dist-infoINSTALLERLICENSE.txtMETADATARECORDWHEELentry_points.txttop_level.txtwheel-0.37.1.virtualenv__init__.py__main__.pybdist_wheel.pycli__init__.pyconvert.pypack.pyunpack.pymacosx_libfile.pymetadata.pypkginfo.pyutil.pyvendored__init__.pypackaging__init__.py_typing.pytags.pywheelfile.pylib64python3.6site-packagesPyYAML-6.0.1.dist-infoINSTALLERLICENSEMETADATARECORD�x��������������.�������XL
.p[?_ini��������������j�endi�$z����������������
j�i�k�
�r/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround �x��������������������XM
ti	?jkea����������
 C.1.2�$0����������������
 C!CC
�w 2.1.3- rebuild- Update to 7.1.0RC3- Update to 7.1.0RC2
- API version is now 20160303- Update to 7.1.0RC1
- oci8 version is now 2.1.2- Update to 7.1.0beta2- Update to 7.1.0beta1- Update to 7.1.0alpha3- own tests/doc directories for pecl packages (f24)- Update to 7.1.0alpha2 (rebuild)- Update to 7.1.0alpha2- Update to 7.1.0alpha1- Update to 7.0.7 - http://www.php.net/releases/7_0_7.php- Update to 7.0.7RC1
- oci8 version is now 2.1.1- Update to 7.0.6 - http://www.php.net/releases/7_0_6.php
- rebuild for new sources- Update to 7.0.6
  http://www.php.net/releases/7_0_6.php- Update to 7.0.6RC1- Fixed bug #71914 (Reference is lost in "switch")- Update to 7.0.5
  http://www.php.net/releases/7_0_5.php- Update to 7.0.5RC1- adapt for F24: define %pecl_xmldir and own it- Update to 7.0.4
  http://www.php.net/releases/7_0_4.php
- pcre: disables JIT compilation of patterns with system pcre < 8.38- Update to 7.0.4RC1- Update to 7.0.3
  http://www.php.net/releases/7_0_3.php- test build- FPM: test build for https://bugs.php.net/62172- Update to 7.0.3RC1- Update to 7.0.2
  http://www.php.net/releases/7_0_2.php- Update to 7.0.2RC1
- opcache: build with --disable-huge-code-pages on EL-6- Update to 7.0.1
  http://www.php.net/releases/7_0_1.php
- curl: add CURL_SSLVERSION_TLSv1_x constant (EL)
- fpm: switch to UDS on Fedora >= 21- Update to 7.0.1RC1
- drop --disable-huge-code-pages build option on EL-6,
  but keep it disabled in default configuration- build with --disable-huge-code-pages on EL-6- Update to 7.0.0
  http://www.php.net/releases/7_0_0.php- set opcache.huge_code_pages=0 on EL-6
  see  https://bugs.php.net/70973 and https://bugs.php.net/70977- Update to 7.0.0RC8
- set opcache.huge_code_pages=1 on x86_64- Update to 7.0.0RC7 (retagged)- Update to 7.0.0RC7- Update to 7.0.0RC6- php-config: reports all built sapis- rebuild as retagged- Update to 7.0.0RC5
- update php-fpm.d/www.conf comments
- API and Zend API are now set to 20151012- Update to 7.0.0RC4
- php-fpm: set http authorization headers- F23 rebuild with rh_layout- Update to 7.0.0RC3
- disable zip extension (provided in php-pecl-zip)- Update to 7.0.0RC2
- enable oci8 and pdo_oci extensions
- sync php.ini with upstream php.ini-production- Update to 7.0.0RC1- Update to 7.0.0beta3- Update to 7.0.0beta2
- switch from libvpx to libwebp (only for bundled libgd, not used)- Update to 7.0.0beta1
- use upstream tarball instead of git snapshot- Update to 7.0.0alpha2
- use new layout (/etc/opt, /var/opt)- new snapshot- new snapshot
- the phar link is now correctly created- Update to 7.0.0alpha1- new snapshot- new snapshot
- t1lib support have been removed- new snapshot- new snapshot- new snapshot- add experimental file based opcode cache (disabled by default)- new snapshot- new snapshot
- adapt system tzdata patch for upstream change for new zic- new snapshot- new snapshot- new snapshot- rename 10-php70-php.conf to 15-php70-php.conf to
  ensure load order (after 10-rh-php56-php.conf)- rebuild- fix mod_php configuration
- disable static json
- sync php.ini with upstream php.ini-production- update for php 7.0.0
- ereg, mssql, mysql and sybase_ct extensions are removed
- add pdo-dblib subpackage (instead of php-mssql)
- disable oci8 extension, not yet adapted for 7.0
- add php-zip subpackage
- add php-json subpackage- Update to 5.6.7
  http://www.php.net/releases/5_6_7.php- update to 5.6.7RC1- Update to 5.6.6
  http://www.php.net/releases/5_6_6.php- Update to 5.6.5
  http://www.php.net/releases/5_6_5.php- fix php-fpm.service.d location- update to 5.6.5RC1
- add base system path in default include path
- FPM: enable ACL for Unix Domain Socket- Update to 5.6.4
  http://www.php.net/releases/5_6_4.php
- add sybase_ct extension (in mssql sub-package)
- xmlrpc requires xml- Update to 5.6.4
  http://www.php.net/releases/5_6_4.php- update to 5.6.4RC1- add embedded sub package
- filter all libraries to avoid provides- FPM: add upstream patch for https://bugs.php.net/68421
  access.format=R doesn't lo�x�������������x
�������XN
ss�? on ؂������x(������͞ lis�$]����������������
͞Ξ
�Q�L?�dd
�
�"
�)
�	2
�	�
��
��
�

�
 
�
-
�
�
�	
�
�
�$
�*
1
�
�
�
	�

�
 
*

�
�
�
,
X
�tT\�(�
8��9h�:,G�>�
@�
B�
F�
G�
H�8
I�`
X�lY��Z��
[��
\��
]� 
^��b��
d��
e��
f��
l��
t�
u�0
v�Xw��
x�$
y�L2��
��
��
��`


�t

�x
��
��

��

��
��0

�4
�@
g�D
h�H
CPercona-Server-shared-compat-575.7.3235.1.el8Shared compat libraries for Percona Server 5.6.28-76.1 database client applicationsThis package contains the shared compat libraries for Percona Server 5.6.28-76.1 client
applications._���minimal-centos-8-x64-2265.ci.percona.comnx�Percona, IncCopyright (c) 2000, 2015, Oracle and/or its affiliates. All rights reserved. Under the GNU General Public License (http://www.gnu.org/licenses/).Percona MySQL Development Team <mysqldev@percona.com>Applications/Databaseshttp://www.percona.com/linuxx86_64for lib in libmysqlclient{.so.18.0.0,.so.18,_r.so.18.0.0,_r.so.18}; do
  if [ ! -f /usr/lib64/mysql/${lib} ]; then
    ln -s libmysqlclient.so.18.1.0 /usr/lib64/mysql/${lib};
  fi
done
/sbin/ldconfigfor lib in libmysqlclient{.so.18.0.0,.so.18,_r.so.18.0.0,_r.so.18}; do
  if [ -h /usr/lib64/mysql/${lib} ]; then
    rm -f /usr/lib64/mysql/${lib};
  fi
done
/sbin/ldconfig467;�7;�
a��A�A���A���A큤_��w_���_���_���_���_���_��a_��a_���_��|598466b4954bc66c6f45f1f119211b0698d4a549f6c01b5d9a933a2511b826264f9e1e5346ab2cf8813e49eca3757a0b33d89ae871cefbbb269a4f98cce8e8554f9e1e5346ab2cf8813e49eca3757a0b33d89ae871cefbbb269a4f98cce8e855600090ca8703ac1531d1224f0afdaadb0eacb7ef98f4f2f9cacd45318d1bb080../../../../usr/lib64/mysql/libmysqlclient.so.18.1.0../../../../usr/lib64/mysql/libmysqlclient_r.so.18.1.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootPercona-Server-57-5.7.32-35.1.el8.src.rpm������������������������������������MySQL-shared-compat(x86-64)Percona-Server-shared-compat-57Percona-Server-shared-compat-57(x86-64)libmysqlclient.so.18()(64bit)libmysqlclient.so.18()(64bit)libmysqlclient.so.18(libmysqlclient_16)(64bit)libmysqlclient.so.18(libmysqlclient_16)(64bit)libmysqlclient.so.18(libmysqlclient_18)(64bit)libmysqlclient.so.18(libmysqlclient_18)(64bit)mysql-libs-compatmysql-libs-compat(x86-64)@@@@@@@@@@@@@@@@@@@@







@/bin/sh/bin/shlibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.10()(64bit)libcrypto.so.10(libcrypto.so.10)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgcc_s.so.1()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)libssl.so.10()(64bit)libssl.so.10(libssl.so.10)(64bit)libstdc++.so.6()(64bit)rpmlib(CompressedFileNames)rpmlib�x�������������������XO
ar�	?/phpx�������������55 add�$%����������������
554565
��������������������������������������������������������������������������������������������������������������������������������
	

1.0.2-22.el81.0.2-22.el8

	





                 !!!!!""""####$$$%%%%%%%%%%%&&&&&&&&''((((((('''))))'*******+++,,+---------..............................//////0011111222111111033330444444455444444444444444444444444444466444444077777708899999988888888888888888800:::::;;;:::<<<<<<<<:::===:>>>>>:??????0@@@@@@@@0AAAAA0BBBBBBBBBBB0CCCCCCCCDDCC0EE0FFFFFFFF0GGGGG00HHHHHHHHHHHHHHHHHH0IIJJIIII00KKKKKKKKKKK0LLL0MMMMMMNNNOOONNNNNMMMMPPQQPPRRMMMMSSSSSSSSSSSS00TTTTT�x�������������h������XP
i�?ik��hr������,�loi�$<����������������
,�-�+�
�457fb959ba2053842c5e0d60605a5ed7528fca2727414700cf3783c3f1309d2f3051d0a7ff736763340d192e07c3ff423f0de85347ab849c3065d18212590e1119d1fd01ea23a67467ef8196a118752d1ee5a6f31982af9f5cc810a708a37d04726209097352db267635e00812bf419e9d1b010850280b4d7a064e106ee70ac4bb41df4bc646811997d0390c6d37d839d2aef4a9a1a940c44ee1a798a9dc1ac864185b151a665848d8ee518342b9a88a2d64898b0b1a2d01b12be731f75d48943bd0c3045ba5071b8375fde6165d4e4db9b69f49af5d2525cecd2bca1cb7538552772e5773586a236034156ac660f8d234bf50f4cebf5811b15b55b890b83cef64e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855ff4956721a3f53e56e25ffffde62fe4fa0267e5dd94c3411def12de50322fb8ffaf87e628c54f166bf1f74eb91a18a10aefe5a19baa6b103e450d500464d4827885ec2a43042ad88d7f849e5e1cbef4e34e58229764a84a927c0e09cd7d47d706802adfc8efc6168f87e98e960fa7d15e516a295fef7a6472ef5359527e886ffe3624a553821869612788f30ba9f3addfbcdce807084f7bb2afeb1da4ba22abe180e50b3c356959742a81ce0a0244465b4ed61c610893a2bfd1ea31af24504e761caecb258234733fc371949a5be67d6c5932769913c47707fff4e4424147ca9e9705e3e6a8c35eaf6b564a675197e29759ab17633ab3faaa9d0918ac1fd667604155f72350f6c90594220e2efdb878912b1f6b8b1b6392b1b05c2b4e6a8ae3625d11c081ac8db545bca94e12c3aed0e789a1c8f5a4fc1ad92fa58df00bb50bd71c724d2e223db5fa65237fe82758c8ce9a65f237f07d9be90b03b6799c58774a153f74ecd9562d03e9adb8d15d76e3e5cacd6981ac1d70da6a6df21c84230bb085e5d8b23655a5e1e72e092282b27c9f7b22e5ce2c3416ce655cc1556f7d60074da028c4ca5a45cfaf2223a19542fb3c5aba8485d5e219a019534c4cffd25d12fed738187755ce24f09aa23430dd417169c64c50c515f8f8c5980b79347db011d54b38c2f37225ab76238aa00a826ed0f3ee7b0e7789f781114e9c53731f87bc55a63ab7c8d39659d511915026dcc1c7f709c9e85d6502cc73a5665345e62427b641951dbe0cadda88491cb856fc88b3e494a8708bdeed67708869879a62c332d5eb182ea09e71f5a94ac1c29d351a4c384fa34ba0bb609b1c88590b86921802ab8e1f9042f86c9f0e5b61e68eeedca07c1a770050e4e10b77ae226e97b0c6a6009e167d7ef51fd2f493a86baacbde6a0c2794f7b52ec76f8f9a0b108221157c75b2d990fe5c55ca5bc22d979991a34033651f10b2b32da2eb9502912a6d7430e02a6e4f66ed7acd56ba7a04766de8a917a6b3574adefab489756f9e6b2347a44b1c7ba126e6eb0c1715c6097abd48b993d72a2d972097110a9b348cf1c1ce7c987550b3eb3d640c87166ebebcd833e668461a942aeb627e6fc5d6716775eed280588f9eda32a091c33c95df6e871b2b65c85e12c155dec934c569bc6f04e474f77814defdba63661699c3b04ef532d7c3ab150a788084d523131d155f78b2e602336d07b63c697ccb7fb532fd0475e050befdf1f14f6edab518dd5653af0ac7e1ea57a421643b1d0f7ee812edbd2f89ac23c11dd68fcaa61e433ae5d420c8582f8db8d99382f325bf49051e286b1f4eb13be6f040562ba947cae046a7cf1e971179757690cc65ac7ea3857df60c7e3a6c74c539b369ba2f26fa46800b274559b5b951b19c7077f74f87ca6e979c9cf5566fd8b3fa45202bf1d8577db39722fb6883eea054a641d1e5dfea7ed9fe7600bae91042caec6b115677ddb431ede57068e3366d67fd1be947a1e62cf4a1d372fcf7f3a089198d7d0d6713da8e4108a418d01642cbc7625ecbf742a94432c531ac837fb85996255d38813163418cc9203a6f72846c79bc42533fb3fc70d5aab9a4ac6a833d0c97413eb303c087a60d9dfc9ceeb094e2a122d5eef432ab7bc48336876fd7211557faa7eec1df470e96aac72085c5c065531df276223c76f0f0bb3b50d03459a2e8d4cb5e594500adb145cffe316662588c5fd35bac6d3273b1e6a53d603b57b43663403e5c9adaca0e9336fe60d9f265d436dd6dddf715e559a1c6acbc1cd39a7369d319682df2509fe216f649778836405f443d8b23a01549502df3eeebb53068ed1cefa0b0ad95b6b86c78761dcafd3ed79bee93d9164e0f2c272f5e941bb10be5ef6719ef1374af0d4e8996ed5502606de5ebf12b42ddbc68cc5e2686f1de42cd9924c5b2bc1f85692198bd7c3dcca201cc121d0868e3a7b5c0bef54d3476d8a71d0ca7a78495457d4468ff275d79cc69a5edc6b65fc28de34bde9fb6869a1dfee1027e2abb547fde4342d059914e0f9e688749faff96f9ffc443aa32103d9f87334effc2300b53c4e8bd82d18f6560e5a3fdc5ec4799e11c1e8c88902c8fcd94647492620dda34a68517a121bb78f0162d41218dc2e277a505ffd353045e1a05c65acf5e08b0e8ce271f58b82c60461dca650a5a7a70661414d11635c85303029acf30efc36066b555e075ed1beb48c449ebe1445fc5f9e9628d5b397fd3add11a2db7284fa82bb3983586b54d17befa828ede129e76736ae9eb8c1f3533812c1f7dc2b012c1a4db6ed0bd29835e7b13578ec96ad13821a3177432�x���������������������XQ
bb�?1da3�� *\�91d�$L����������������
\�]�[�
�3David Malcolm <dmalcolm@redhat.com> - 2.6.4-2David Malcolm <dmalcolm@redhat.com> - 2.6.4-1Tomas Mraz <tmraz@redhat.com> - 2.6.2-2James Antill <james.antill@redhat.com> - 2.6.2-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.6-11Jonathan Steffan <jsteffan@fedoraproject.org> - 2.6-10Jonathan Steffan <jsteffan@fedoraproject.org> - 2.6-9Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> 2.6-8James Antill <james@fedoraproject.org> - 2.6-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.6-5Tomas Mraz <tmraz@redhat.com> - 2.6-4James Antill <james.antill@redhat.com> - 2.6-3Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 2.6-2Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 2.6-1James Antill <james.antill@redhat.com> - 2.5.2-1Jeremy Katz <katzj@redhat.com> - 2.5.1-30Tom "spot" Callaway <tcallawa@redhat.com> - 2.5.1-27James Antill <jantill@redhat.com> - 2.5.1-26James Antill <jantill@redhat.com> - 2.5.1-25James Antill <jantill@redhat.com> - 2.5.1-24James Antill <jantill@redhat.com> - 2.5.1-22Fedora Release Engineering <rel-eng@fedoraproject.org> - 2.5.1-22Tom "spot" Callaway <tcallawa@redhat.com> - 2.5.1-21James Antill <jantill@redhat.com> - 2.5.1-20Tom "spot" Callaway <tcallawa@redhat.com> - 2.5.1-19James Antill <jantill@redhat.com> - 2.5.1-18Jeremy Katz <katzj@redhat.com> - 2.5.1-17James Antill <jantill@redhat.com> - 2.5.1-16James Antill <jantill@redhat.com> - 2.5.1-15James Antill <jantill@redhat.com> - 2.5.1-14James Antill <jantill@redhat.com> - 2.5.1-13Mike Bonnet <mikeb@redhat.com> - 2.5.1-12Jeremy Katz <katzj@redhat.com> - 2.5.1-11Jeremy Katz <katzj@redhat.com> - 2.5.1-10Jeremy Katz <katzj@redhat.com> - 2.5.1-9Jeremy Katz <katzj@redhat.com> - 2.5.1-8Dennis Gilmore <dennis@ausil.us> - 2.5.1-7Jeremy Katz <katzj@redhat.com> - 2.5.1-6Jeremy Katz <katzj@redhat.com> - 2.5.1-5Jeremy Katz <katzj@redhat.com> - 2.5.1-4Jeremy Katz <katzj@redhat.com> - 2.5.1-3Jeremy Katz <katzj@redhat.com> - 2.5.1-2Jeremy Katz <katzj@redhat.com> - 2.5.1-1Jeremy Katz <katzj@redhat.com> - 2.5.3-12Jeremy Katz <katzj@redhat.com> - 2.5.3-11Jeremy Katz <katzj@redhat.com> - 2.5.3-10Miroslav Lichvar <mlichvar@redhat.com> - 2.5.3-9Jeremy Katz <katzj@redhat.com> - 2.5.3-8Jeremy Katz <katzj@redhat.com> - 2.5.3-7Jeremy Katz <katzj@redhat.com> - 2.5.3-6Jarod Wilson <jwilson@redhat.com> - 2.5.3-5Jeremy Katz <katzj@redhat.com> - 2.5.3-4Jeremy Katz <katzj@redhat.com> - 2.5.3-3Jeremy Katz <katzj@redhat.com> - 2.5.3-2Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com> - 2.5-0Mihai Ibanescu <misa@redhat.com> - 2.4.99.c1Mihai Ibanescu <misa@redhat.com> - 2.4.99.b2Mihai Ibanescu <misa@redhat.com> - 2.4.99.b1Jeremy Katz <katzj@redhat.com> - 2.4.3-11.FC6Jeremy Katz <katzj@redhat.com> - 2.4.3-10.FC6Mihai Ibanescu <misa@redhat.com> - 2.4.3-9Mihai Ibanescu <misa@redhat.com> - 2.4.3-8Mihai Ibanescu <misa@redhat.com> - 2.4.3-7Mihai Ibanescu <misa@redhat.com> - 2.4.3-6Mihai Ibanescu <misa@redhat.com> - 2.4.3-5Mihai Ibanescu <misa@redhat.com> - 2.4.3-4Mihai Ibanescu <misa@redhat.com> - 2.4.3-3Jeremy Katz <katzj@redhat.com> - 2.4.3-2Mihai Ibanescu <misa@redhat.com> - 2.4.3-1Jesse Keating <jkeating@redhat.com> - 2.4.2-3.2.1Mihai Ibanescu <misa@redhat.com> - 2.4.3-3.2Jesse Keating <jkeating@redhat.com> - 2.4.2-3.1Mihai Ibanescu <misa@redhat.com> 2.4.2-3Jesse Keating <jkeating@redhat.com>Bill Nottingham <notting@redhat.com> 2.4.2-2Mihai Ibanescu <misa@redhat.com> 2.4.2-1Mihai Ibanescu <misa@redhat.com> 2.4.1-16Peter Jones <pjones@redhat.com> 2.4.1-14Peter Jones <pjones@redhat.com> 2.4.1-13Peter Jones <pjones@redhat.com> 2.4.1-12Mihai Ibanescu <misa@redhat.com> 2.4.1-10Peter Jones <pjones@redhat.com> 2.4.1-8Mihai Ibanescu <misa@redhat.com> 2.4.1-7Mihai Ibanescu <misa@redhat.com> 2.4.1-4Mihai Ibanescu <misa@redhat.com> 2.4.1-3Mihai Ibanescu <misa@redhat.com> 2.4.1-2Mihai Ibanescu <misa@redhat.com> 2.4.1-1Mihai Ibanescu <misa@redhat.com> 2.4-6Dan Williams <dcbw@redhat.com> 2.4-5Mihai Ibanescu �x�������������X�������XR
�?R�{������
[�R �$K����������������
[�\�Z�
�<misa@redhat.com> 2.4-4Tim Waugh <twaugh@redhat.com> 2.4-3Jeff Johnson <jbj@jbj.org> 2.4-2Mihai Ibanescu <misa@redhat.com> 2.4-1Mihai Ibanescu <misa@redhat.com> 2.4-0.c1.1Jeff Johnson <jbj@jbj.org> 2.4-0.b2.4Jeremy Katz <katzj@redhat.com> - 2.4-0.b2.3Jeremy Katz <katzj@redhat.com> - 2.4-0.b2.2Mihai Ibanescu <misa@redhat.com> 2.4-0.b2.1Mihai Ibanescu <misa@redhat.com> 2.3.4-13Mihai Ibanescu <misa@redhat.com> 2.3.4-12Mihai Ibanescu <misa@redhat.com> 2.3.4-11Mihai Ibanescu <misa@redhat.com> 2.3.4-10Mihai Ibanescu <misa@redhat.com> 2.3.4-8Mihai Ibanescu <misa@redhat.com> 2.3.4-7Mihai Ibanescu <misa@redhat.com> 2.3.4-6Elliot Lee <sopwith@redhat.com>Mihai Ibanescu <misa@redhat.com> 2.3.4-3Mihai Ibanescu <misa@redhat.com> 2.3.4-2Mihai Ibanescu <misa@redhat.com> 2.3.4-1Mihai Ibanescu <misa@redhat.com> 2.3.3-6Mihai Ibanescu <misa@redhat.com> 2.3.3-4Mihai Ibanescu <misa@redhat.com> 2.3.3-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Jeff Johnson <jbj@jbj.org> 2.3.3-1Jeff Johnson <jbj@jbj.org> 2.3.2-9Jeremy Katz <katzj@redhat.com> 2.3.2-8Jeff Johnson <jbj@jbj.org> 2.3.2-7.1Mihai Ibanescu <misa@redhat.com> 2.3.2-7Mihai Ibanescu <misa@redhat.com> 2.3.2-6Mihai Ibanescu <misa@redhat.com> 2.3.2-5Jeremy Katz <katzj@redhat.com> 2.3.2-4Mihai Ibanescu <misa@redhat.com> 2.3.2-2Mihai Ibanescu <misa@redhat.com> 2.3.2-1Mihai Ibanescu <misa@redhat.com> 2.3.1-1Mihai Ibanescu <misa@redhat.com> 2.3.1-0.8.RC1Mihai Ibanescu <misa@redhat.com> 2.3-0.2Mihai Ibanescu <misa@redhat.com> 2.2.3-4Elliot Lee <sopwith@redhat.com> 2.2.3-3Mihai Ibanescu <misa@redhat.com> 2.2.3-2Mihai Ibanescu <misa@redhat.com> 2.2.3-1Mihai Ibanescu <misa@redhat.com> 2.2.2-28Mihai Ibanescu <misa@redhat.com> 2.2.2-27Elliot Lee <sopwith@redhat.com>Mihai Ibanescu <misa@redhat.com> 2.2.2-25Jeremy Katz <katzj@redhat.com> 2.2.2-23Mihai Ibanescu <misa@redhat.com> 2.2.2-22Mihai Ibanescu <misa@redhat.com> 2.2.2-21Mihai Ibanescu <misa@redhat.com> 2.2.2-20Mihai Ibanescu <misa@redhat.com> 2.2.2-13Mihai Ibanescu <misa@redhat.com> 2.2.2-12Mihai Ibanescu <misa@redhat.com> 2.2.2-11.7.3Tim Powers <timp@redhat.com>Jens Petersen <petersen@redhat.com> 2.2.2-10Nalin Dahyabhai <nalin@redhat.com> 2.2.2-9Nalin Dahyabhai <nalin@redhat.com>Jeremy Katz <katzj@redhat.com> 2.2.2-8Mihai Ibanescu <misa@redhat.com> 2.2.2-7Tim Powers <timp@redhat.com> 2.2.2-6Mihai Ibanescu <misa@redhat.com>Mihai Ibanescu <misa@redhat.com>Mihai Ibanescu <misa@redhat.com>Mihai Ibanescu <misa@redhat.com>Mihai Ibanescu <misa@redhat.com>Mihai Ibanescu <misa@redhat.com>Mihai Ibanescu <misa@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-17Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-16Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-15Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-14Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-13Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-12Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-11Tim Powers <timp@redhat.com> 2.2.1-10Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-9Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-8Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-7Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-6Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-5Than Ngo <than@redhat.com> 2.2.1-4Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-2Trond Eivind Glomsrød <teg@redhat.com> 2.2.1-1Trond Eivind Glomsrød <teg@redhat.com> 2.2-16Trond Eivind Glomsrød <teg@redhat.com> 2.2-15Trond Eivind Glomsrød <teg@redhat.com> 2.2-14Trond Eivind Glomsrød <teg@redhat.com> 2.2-13Trond Eivind Glomsrød <teg@redhat.com> 2.2-12Trond Eivind Glomsrød <teg@redhat.com> 2.2-11Trond Eivind Glomsrød <teg@redhat.com> 2.2-10Trond Eivind Glomsrød <teg@redhat.com> 2.2-9Trond Eivind Glomsrød <teg@redhat.com> 2.2-8Elliot Lee <sopwith@redhat.com> 2.2-7Trond Eivind Glomsrød <teg@redhat.com> 2.2-6Nalin Dahyabhai <nalin@redhat.com> 2.2-5Trond Eivind Glomsrød <teg@redhat.com> 2.2-4Trond Eivind Glomsrød <teg@redhat.com> 2.2-3Trond Eivind Glomsrød <t�x�������������к�������XS
 31?4-3��
�!5eeri�$����������������
555
�.0-16Marek Polacek <polacek@redhat.com> 8.5.0-15Jonathan Wakely <jwakely@redhat.com> 8.5.0-14Marek Polacek <polacek@redhat.com> 8.5.0-13Marek Polacek <polacek@redhat.com> 8.5.0-12Marek Polacek <polacek@redhat.com> 8.5.0-11Marek Polacek <polacek@redhat.com> 8.5.0-10Marek Polacek <polacek@redhat.com> 8.5.0-9Marek Polacek <polacek@redhat.com> 8.5.0-8Marek Polacek <polacek@redhat.com> 8.5.0-7Marek Polacek <polacek@redhat.com> 8.5.0-6Marek Polacek <polacek@redhat.com> 8.5.0-5Marek Polacek <polacek@redhat.com> 8.5.0-4Marek Polacek <polacek@redhat.com> 8.5.0-3Marek Polacek <polacek@redhat.com> 8.5.0-2Marek Polacek <polacek@redhat.com> 8.5.0-1Marek Polacek <polacek@redhat.com> 8.4.1-2.1Marek Polacek <polacek@redhat.com> 8.4.1-2Marek Polacek <polacek@redhat.com> 8.4.1-1.2Marek Polacek <polacek@redhat.com> 8.4.1-1.1Marek Polacek <polacek@redhat.com> 8.4.1-1Marek Polacek <polacek@redhat.com> 8.3.1-5.2Marek Polacek <polacek@redhat.com> 8.3.1-5.1Marek Polacek <polacek@redhat.com> 8.3.1-5Marek Polacek <polacek@redhat.com> 8.3.1-4.5Marek Polacek <polacek@redhat.com> 8.3.1-4.4Marek Polacek <polacek@redhat.com> 8.3.1-4.3Marek Polacek <polacek@redhat.com> 8.3.1-4.2Marek Polacek <polacek@redhat.com> 8.3.1-4.1Marek Polacek <polacek@redhat.com> 8.3.1-4Marek Polacek <polacek@redhat.com> 8.3.1-3Marek Polacek <polacek@redhat.com> 8.2.1-3.5Jeff Law <law@redhat.com> 8.2.1-3.4Marek Polacek <polacek@redhat.com> 8.2.1-3.3Marek Polacek <polacek@redhat.com> 8.2.1-3.2Marek Polacek <polacek@redhat.com> 8.2.1-3.1Marek Polacek <polacek@redhat.com> 8.2.1-3Marek Polacek <polacek@redhat.com> 8.2.1-1.3Marek Polacek <polacek@redhat.com> 8.2.1-1.2Marek Polacek <polacek@redhat.com> 8.2.1-1.1Marek Polacek <polacek@redhat.com> 8.2.1-1Marek Polacek <polacek@redhat.com> 8.1.1-5Marek Polacek <polacek@redhat.com> 8.1.1-1.1Marek Polacek <polacek@redhat.com> 8.1.1-1Marek Polacek <polacek@redhat.com> 8.0.1-0.23- don't reuse DEBUG_EXPRs with vector type (PR middle-end/100508, RHEL-79501)- rebuild for CVE-2020-11023 (RHEL-78274)- fix ICE in the vectorizer (RHEL-32886)- guard the bit test merging code in if-combine (RHEL-11483)- fix for TLSLD references (#2213753)
- fix crash in dynamic_cast<>() on null pointer (PR c++/99074, #2211506)
- adjust a pattern in s390.md (PR target/87723, #2214847)- s390x: add support for register arguments preserving (#2168205)- fix strlen range with a flexible member array (#2137448)- fix deserialization for std::normal_distribution (#2130392,
  PR libstdc++/105502)
- initialize std::normal_distribution::_M_saved (PR libstdc++/99536)
- reject std::make_shared<T[]> (PR libstdc++/99006)- avoid changing PHIs in GIMPLE split_edge (#2117838)- backport straight-line-speculation mitigation (#2108721)- backport std::regex check for invalid range (#2001788)- require docbook-style-xsl instead of docbook5-style-xsl (#2073888)
- backport Default widths with -fdec-format-defaults patch (#2074614)- Fix nop generation in annobin plugin.  (#2067150)- Add a plugin-annobin subpackage.  (#2067150)- fix typo in the cprop_hardreg patch (#2028609)- apply cprop_hardreg fix for narrow mode != lowpart targets (#2028609)- aarch64: Add -mtune=neoverse-512tvb (#1845932)- backport PCH tweaks (#2030878)- avoid cycling on certain subreg reloads (PR rtl-optimization/96796, #2028798)- when linking against libgcc_s, link libgcc.a too (#2022588)- add -Wbidi-chars patch (#2008392)- fix mangling of lambdas in default args (PR c++/91241, #1981822)
- add a few Provides: bundled- revert upstream PR85873 gcc-8 fix, apply the fix from gcc-9 (#1960701)
- fix 'this' adjustment for devirtualized call (PR c++/100797, #1965951)- update from GCC 8.5 release (#1946758)
- this includes a fix for PR target/87839 (#1958295)- remove support for demangling GCC 2.x era mangling schemes (#1668394)- update from GCC 8.4 release (#1946758)- back out the PR97236 patch- fix bad use of VMAT_CONTIGUOUS (PR tree-optimization/97236, #1925632)- update from GCC 8.4 release (#1868446)
- remove symlinks to 32-bit v�x�������������H��������XT
@r�?t.co��������`�T� Har�$D����������������
T�U�S�
�34: fix various integer overflow checks in the audioop
module (patch 116)
- CVE-2010-2089: further checks within the audioop module (patch 117)
- CVE-2008-5983: the new PySys_SetArgvEx entry point from r81399 (patch 118)- make "pydoc -k" more robust in the face of broken modules (rhbz:461419, patch115)- add flags for statvfs.f_flag to the constant list in posixmodule (i.e. "os")
(patch 114)- add configure-time support for COUNT_ALLOCS and CALL_PROFILE debug options
(patch 113); enable them and the WITH_TSC option within the debug build- build and install two different configurations of Python: debug and standard,
packaging the debug build in a new "python-debug" subpackage (patch 112)- don't delete wsgiref.egg-info (rhbz:588426)- disable --with-valgrind on sparc arches- move the "bdist_wininst" command's template .exe files from the core package
to the devel subpackage, to save space (rhbz:525469)
- fix stray doublelisting of config directory wildcard in devel subpackage- update python-gdb.py from v4 to v5 (improving performance and stability,
adding commands)- update python-gdb.py from v3 to v4 (fixing infinite recursion on reference
cycles and tracebacks on bytes 0x80-0xff in strings, adding handlers for sets
and exceptions)- refresh gdb hooks to v3 (reworking how they are packaged)- remove unnecessary arch-conditionality for patch 101- update to 2.6.5: http://www.python.org/download/releases/2.6.5/
- replace our patch to compile against db4.8 with a patch from
upstream (patch 53, from r78974); update patch 54 since part of it is now in
that upstream patch
- update patch 110 so that it still applies in the face of upstream r78380- fixup distutils/unixccompiler.py to remove standard library path from
rpath (patch 17)
- delete DOS batch files- add pyfuntop.stp; allow systemtap support to be disabled
- remove trailing period from tkinter summary
- don't own /usr/bin/python-config if you're not the main python- rebuild with new gdbm- avoid having the "test" subdirectory and the files within it that are in the
core subpackage also be owned by the test subpackage (rhbz:467588)- revise the systemtap patch (patch 55:python-2.6.4-dtrace.patch) to the
new version by mjw in attachment 390110 of rhbz:545179, as this should
eliminate the performance penalty for the case where the probes aren't in
use, and eliminate all architecture-specific code (rhbz:563541; except on
sparc)- add a systemtap tapset defining "python.function.entry" and
"python.function.return" to make it easy to use the static probepoint within
Python; add an example of using the tapset to the docs- add systemtap static probes (wcohen; patch 55; rh bug #545179)
- update some comments in specfile relating to gdb work
- manually byte-compile the gdb.py file with the freshly-built python to ensure
that .pyx and .pyo files make it into the debuginfo manifest if they are later
byte-compiled after find-debuginfo.sh is run- move the -gdb.py file from %{_libdir}/INSTSONAME-gdb.py to
%{_prefix}/lib/debug/%{_libdir}/INSTSONAME.debug-gdb.py to avoid noise from
ldconfig (bug 562980), and which should also ensure it becomes part of the
debuginfo subpackage, rather than the libs subpackage
- introduce %{py_SOVERSION} and %{py_INSTSONAME} to reflect the upstream
configure script, and to avoid fragile scripts that try to figure this out
dynamically (e.g. for the -gdb.py change)- work around bug 562906 by supplying a fixed version of pythondeps.sh
- set %{_python_bytecompile_errors_terminate_build} to 0 to prevent the broken
test files from killing the build on buildroots where python is installed- add gdb hooks for easier debugging- document all patches, and remove the commented-out ones- Address some of the issues identified in package review (bug 226342):
  - update libs requirement on base package to use %{name} for consistency's
sake
  - convert from backticks to $() syntax throughout
  - wrap value of LD_LIBRARY_PATH in quotes
  - convert "/usr/bin/find" requirement to "findutils"
  - remove trailing periods from summaries of �x����������������������XU
om�?1.17����������������rhar�$|����������������
��
�G
��?
�d
�
�
�
�	
�	@
��
��
�
 
�
$
�
2
�
8
�
<
�	
Z
�
r
�
�
�
�

�

�
	
�


<
�

�
�
)
j
�
��!L!	�!(
:
8
D�9��:���G
��
H
�(
I
�\
X
�lY
�\
�
]
��
^
��b
�B
d
�
e
�
f
�
l
�
t
�
u
��
v
�w
�D
x
�x
y
�:�
�
�
�
�
�
�
�
�
�



�


�

�$6


�Z


�
�
��


��

��
g
��
h
��
Clibkadm51.18.232.el8_10Kerberos 5 Administrative librariesKerberos is a network authentication system. The libkadm5 package
contains only the libkadm5clnt and libkadm5serv shared objects. This
interface is not considered stable.h?`Uord1-prod-x86build008.svc.aws.rockylinux.orglpRocky Linux 8RockyMITinfrastructure@rockylinux.orgSystem Environment/Basehttp://web.mit.edu/kerberos/www/linuxx86_64.-
�X
�A�A�A���������������h?`Rh?`Rh?`Rh?`Rh?`Rh?`Oh?`Oh?`Oh?`Qh?`Oh?`Oh?`Oh?`Q56959a55a78597de898736841fee8edf2965efc11eaf4c05ad22d40e704c59afbb774ca3847d58404496afb8fd84198e219e5f7ecacbdbe345d1b31a971f1730../../../../usr/lib64/libkadm5clnt_mit.so.12.0../../../../usr/lib64/libkadm5srv_mit.so.12.0libkadm5clnt_mit.solibkadm5clnt_mit.so.12.0libkadm5clnt_mit.so.12.0libkadm5srv_mit.solibkadm5srv_mit.so.12.0libkadm5srv_mit.so.12.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootkrb5-1.18.2-32.el8_10.src.rpm����������������������������������������������������libkadm5libkadm5(x86-64)libkadm5clnt_mit.so.12()(64bit)libkadm5clnt_mit.so.12(HIDDEN)(64bit)libkadm5clnt_mit.so.12(kadm5clnt_mit_12_MIT)(64bit)libkadm5srv_mit.so.12()(64bit)libkadm5srv_mit.so.12(HIDDEN)(64bit)libkadm5srv_mit.so.12(kadm5srv_mit_12_MIT)(64bit)@@@@@@@@@@@@@@@@@@@@@@@@@@@







@krb5-libs(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcom_err.so.2()(64bit)libcrypto.so.1.1()(64bit)libgssapi_krb5.so.2()(64bit)libgssapi_krb5.so.2(gssapi_krb5_2_MIT)(64bit)libgssrpc.so.4()(64bit)libgssrpc.so.4(gssrpc_4_MIT)(64bit)libk5crypto.so.3()(64bit)libk5crypto.so.3(k5crypto_3_MIT)(64bit)libkadm5clnt_mit.so.12()(64bit)libkadm5srv_mit.so.12()(64bit)libkdb5.so.10()(64bit)libkdb5.so.10(kdb5_10_MIT)(64bit)libkeyutils.so.1()(64bit)libkrb5.so.3()(64bit)libkrb5.so.3(krb5_3_MIT)(64bit)libkrb5support.so.0()(64bit)libkrb5support.so.0(krb5support_0_MIT)(64bit)libresolv.so.2()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1.18.2-32.el8_103.0.4-14.6.0-14.0-15.2-14.14.3h
'�g�;�g�@f��@f-�e�!@e@d���d�[@dw6�cjD�b��bi0@bV�@b8h�a&0�`���`���`���`��`~�@_��_���_�"�_�9�_��@_)M�_ @^�b�^�V@^Ǿ�^�I�^��^���^�k@^M#@]�|@]�*�]�*�]�*�]��@]���]���]���]��]J�@\�]@\�@\�f�\��@\��\��\��@\\�\T4�\�@[a��[Y��[P}@[P}@[P}@[O+�[L��[GB�[E�@[D��[?Y�[?Y�["X�["X�["X�[@[5@Z�K@Z�x�������������(��������XV
te�?ncp���������������
t-li�$����������������
�
�

Z
(beta)
- drop merged patches
- install doc in pecl doc_dir
- install tests in pecl test_dir- backport stuff- refresh our merged patches from upstream git- New spec for version 1.12.1php74-php-zip


























	

�1.22.3-1.el8.remi1.22.31.22.31.22.3-1.el8.remi1.22.3-1.el8.remi1:1.22.3-1.el8.remi1:1.22.3-1.el8.remi
7.0.0
30-zip.inizip.sozipCREDITSexamplesaddglob.phpaddpattern.phpcomment.phpcreate.phpdir.phpencryption.phpextract.phpextractAll.phpfopen.phpget_set_comments.phpodt.phpoldapi.phpset_compression.phptest.ziptest1.ziptest_with_comment.ziptoo.phpzipcmd.phpphp74-php-pecl-zipLICENSEphp74-php-pecl-zip.xml/etc/opt/remi/php74/php.d//opt/remi/php74/root/usr/lib64/php/modules//opt/remi/php74/root/usr/share/doc/pecl//opt/remi/php74/root/usr/share/doc/pecl/zip//opt/remi/php74/root/usr/share/doc/pecl/zip/examples//opt/remi/php74/root/usr/share/licenses//opt/remi/php74/root/usr/share/licenses/php74-php-pecl-zip//var/opt/remi/php74/lib/php/peclxml/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu
ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=328d31b2b1de47bffc40170f554bdabf92341529, strippeddirectoryPHP script, ASCII textASCII text (Zip archive data, at least v2.0 to extract)ASCII text (Zip archive data, at least v1.0 to extract)XML 1.0 document, ASCII text, with very long lines		RRRRRR
RPR	PR	PR	https://forum.remirepo.net/utf-85ba78edb91a3887e349f71095d16f151140567ce8c67ccf453ad4dd48dc6ed76?����$�[/��@k����,I�3
!k8��#��+���UP�Y_sZeS��
	UP�Y_sZ.��)�Ӛ�6=�be�)3��A`���蒴�	�O�f,׆<T�8�%�{�?@r����K�,��[��{���kVӡo�o!��:��=�h�y}#��
b�"
���������z��(g��[|p�Y���f;������(��Pd��P�c�	L����C��q
�/�V��b}��H~̍��˗mr]��[]�љG�-�P�?�f�d�R
�g>�FY3�����t�3�7�R�ժ���V�Fn���*ɋ��m+I��S+e��|�!���A��Ej���B���q�V2�#
.S[rj;Fa|�wߐ\�|�:J(Q}�\/�Rو��}�Y�pOn�J�F�|�c�`azg+�YAY]�FR$��PO�\?�nķd\O���u�82�|��m�Ac�'nzGh[��O�e�U�:a�TT	@�|�E��<Tu�t��<6��{�5������}^fG�s��*���X$��U/�Ϩ�*�[�@��/�+,�m;��F�\�9e39d849c25550e0f3320b1e8b82a5ce815aadd9b9b2aac1fee294b68e6967d02d21de5c6c230c5b90d1cf4a10af644450020952h�^�h�gava) [1751075]
- [kernel] Revert "printk: make sure to print log on console." (Prarit Bhargava) [1751075]
- [lib] vsprintf: print OF node name using full_name (Prarit Bhargava) [1751075]
- [kernel] printk/tracing: Do not trace printk_nmi_enter() (Prarit Bhargava) [1751075]
- [misc] notifier: Remove notifier header file wherever not used (Prarit Bhargava) [1751075]
- [init] init: allow initcall tables to be emitted using relative references (Prarit Bhargava) [1751075]
- [lib] lib/vsprintf: Do not handle pO[^F] as px (Prarit Bhargava) [1751075]
- [kernel] console: Replace #if 0 with atomic var 'ignore_console_lock_warning' (Prarit Bhargava) [175�x��������������x�������XW
ol�	?<remXi������Ȇ������253.0-�$"����������������
251535
�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������lwdbadmin-python3lwdbadmin-python3(x86-64)







/bin/sh/bin/sh/usr/sbin/useraddpiglet-python3python3-pyOpenSSLrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)0.2.123.0.4-14.6.0-14.0-15.2-14.14.3g-�@f]�@f]�@f]�@f]�@f]�@f]�@fU�@fP�@fP�@fP�@fP�@fP�@fD��e���e���e���e�)�e�)�e�)�dgd�c�U@c�U@c��c�c�T@cױ@a��@]µ�]��@Y�J�X�Q@X��@X��@W�W�@V�I�V��V��Ug@Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-22Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-19Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-18Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-17Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-16Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-15Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-14Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-13Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-11Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-11Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-10Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-9Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-8Anderson Ramos <anderson.ramos@locaweb.com.br> - 1.0.2-7Fabiano Candiotto <fabiano.candiotto@locaweb.com.br> - 1.0.2-6Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-5Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-4Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-3Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-2Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-1Jandy Lopes <jandy.lopes@locaweb.com.br> - 1.0.1Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-5Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-4Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-3Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-2Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-1Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.4-1Jandy Lopes <jandy.lopes@locaweb.com.br> - 4.3Andre Ferraz <andre.ferraz@locaweb.com.br> - 4.2Andre Ferraz <andre.ferraz@locaweb.com.br> - 4.1Edi Carlos <edi.carlos@locaweb.com.br> 4.0Edi Carlos <edi.carlos@locaweb.com.br> 3.8-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 3.7-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 3.6-2Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 3.1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 3.0Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 1.0-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 0.8-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 0.5-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 0.1-1- Fix routes to vpshost- Fix routes to /pgsql- Change to python 3.6 (uwsgi plugin is compatible with python3.6)- Change to python 3.9 (python3.11 caused some errors)- Fix errors- Fix requirements.txt- Fix postgres scripts and convert to python 3.11- Add lwdbadmin.key in auth function- Add PyMySQL in requirements.txt- Cange name of lwdbadmin-python3- Fix some errors- Refact mysql route- Fix package name and location- Changed scripts that was on python2 interpreter to python3 interpreter- New release- Fix virtualenv- Create virtualenv and build to /opt/lc/lwdbadmin- Change log dir to /var/log/lwdbadmin-python3- Fix building to python3- Change build.sh to python3- Convert app to python3- Fix osuser variable to interop between products- Fixed socket path- Minor improvements- Treat errors in proxysql bootstrap
- remove invalid password characters- Added proxysql bootstrap (random admin and monitor credentials, default port 3306)- Implemented new logic to MYSQL Multi-Tenancy
- Now tag description 'reseller' is avaiable to use.- Fixes on lwmyauth script- Fixes on lwmysrvadm- Include lwmyauth script
- Bootstrap adjustments for M�x�������������h�������XX
�?Pr��������������$p����������������
���
�ust make a git repo- Backport getrandom() support
- Remove patch numbering- New upstream release
- Update names and numbers to match external git- Add krb5_db_register_keytab
- Resolves: #1376812- Use responder for non-preauth AS requests
- Resolves: #1370622- Guess Samba client mutual flag using ap_option
- Resolves: #1370980- Fix KDC return code and set prompt types for OTP client preauth
- Resolves: #1370072- Turn OFD locks back on with glibc workaround
- Resolves: #1274922- Fix use of KKDCPP with SNI
- Resolves: #1365027- Make krb5-devel depend on libkadm5
- Resolves: #1364487- Up-port a bunch of stuff from the el-7.3 cycle
- Resolves: #1255450, #1314989- New upstream version 1.14.3- Fix CVE-2016-3120
- Resolves: #1361051- Fix incorrect recv() size calculation in libkrad- Separate out the kadm5 libs- Fix setting of AS key in OTP preauth failure- Use the correct patches this time.
- Resolves: #1321135- Add send/receive sendto_kdc hooks and corresponding tests
- Resolves: #1321135- Fix CVE-2016-3119 (NULL deref in LDAP module)- Backport OID mech fix
- Resolves: #1317609- New rawhide, new upstream version
- Drop CVE patches
- Rename fix_interposer.patch to acquire_cred_interposer.patch
- Update acquire_cred_interposer.patch to apply to new source- Fix log file permissions patch with our selinux
- Resolves: #1309421- Backport my interposer fixes from upstream
  - Supersedes krb5-mechglue_inqure_attrs.patch- Adjust dependency on crypto-polices to be just the file we want
- Patch courtesy of lslebodn
- Resolves: #1308984- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Replace _kadmin/_kprop with systemd macros
- Remove traces of upstart from fedora package per policy
- Resolves: #1290185- Fix CVE-2015-8629, CVE-2015-8630, CVE-2015-8631- Make krb5kdc.log not world-readable by default
- Resolves: #1276484- Allow verification of attributes on krb5.conf- Use "new" systemd macros for service handling.  (Thanks vpavlin!)
- Resolves: #850399- Remove WITH_NSS macro (always false)
- Remove WITH_SYSTEMD macro (always true)
- Remove WITH_LDAP macro (always true)
- Remove WITH_OPENSSL macro (always true)- Backport fix for chrome crash in spnego_gss_inquire_context
- Resolves: #1295893- Backport patch to fix mechglue for gss_inqure_attrs_for_mech()- Backport interposer fix (#1284985)
- Drop workaround pwsize initialization patch (gcc has been fixed)- Fix FTBFS by no longer working around bug in nss_wrapper- Upstream release.  No actual change from beta, just version bump
- Clean up unused parts of spec file- New upstream beta version- Patch CVE-2015-2698- Patch CVE-2015-2697, CVE-2015-2696, CVE-2015-2695- Ensure pwsize is initialized in chpass_util.c- Fix typo of crypto-policies file in previous version- Start using crypto-policies- TEMPORARILY disable usage of OFD locks as a workaround for x86- New upstream beta version- Work around KDC client prinicipal in referrals issue (#1259844)- Enable building with bad system /etc/krb5.conf- Drop dependency on pax, ksh
- Remove support for fedora < 20- Nix /usr/share/krb5.conf.d to reduce complexity- Depend on crypto-policies which provides /etc/krb5.conf.d (#1225792)- Remove dependency on systemd-sysv which is no longer needed for fedora > 20
  This also fixes a fail-to-build issue.
- Miscalaneous spec cleanup fixes- Support config snippets in /etc/krb5.conf.d/ and /usr/share/krb5.conf.d/
  (#1225792, #1146370, #1145808)- Use system nss_wrapper and socket_wrapper for testing.
  Patch by Andreas Schneider <asn@redhat.com>- Remove Zanata test glue and related workarounds
  - Bug #1234292 ("IPA server cannot be run in container due to incorrect /usr/sbin/_kadmind")
  - Bug #1234326 ("krb5-server introduces new rpm dependency on ksh")- Fix dependicy on binfmt.service- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Add patch to fix Redhat Bug #1227542 ("[SELinux] AVC denials may appear
  when kadmind starts"). The issue was caused by an unneeded |htons()|
  which triggered SELinu�x��������������W�������XY
m>�?.1-8��������،
�edha�$����������������
���H
�ogin, pam_securetty,
  pam_shells, and pam_wheel- add system-auth control file
- let gethostname() call in pam_access.c be implicitly declared to avoid
  conflicting types if unistd.c declares it- fix problems compiling on Red Hat Linux 5.x (bug #11005)- fix size assumptions in pam_(pwdb|unix) md5 code- Add new pam_stack module.
- Install pwdb_chkpwd and unix_chkpwd as the current user for non-root builds- Fix pam_xauth bug #6191.- Add a patch to accept 'pts/N' in /etc/securetty as a match for tty '5'
  (which is what other pieces of the system think it is). Fixes bug #7641.- argh, turn off gratuitous debugging- update to 0.72
- fix pam_unix password-changing bug
- fix pam_unix's cracklib support
- change package URL- don't allow '/' on service_name- enhance the pam_userdb module some more- add documenatation- a tiny change to pam_console to make it not loose track of console users- a few fixes to pam_xauth to make it more robust- pam_console: added <xconsole> to manage /dev/console- pam_xauth: New refcounting implementation based on idea from Stephen Tweedie- added video4linux devices to /etc/security/console.perms- added joystick lines to /etc/security/console.perms- fixed a couple segfaults in pam_xauth uncovered by yesterday's fix...- use gcc -shared to link the shared libs- many bug fixes in pam_xauth
- pam_console can now handle broken applications that do not set
  the PAM_TTY item.- fixed glob/regexp confusion in pam_console, added kbd and fixed fb devices
- added pam_xauth module- pam_lastlog does wtmp handling now- added option parsing to pam_console
- added framebuffer devices to default console.perms settings- fixed empty passwd handling in pam_pwdb- changed /dev/cdrom default user permissions back to 0600 in console.perms
  because some cdrom players open O_RDWR.- added /dev/jaz and /dev/zip to console.perms- changed the default user permissions for /dev/cdrom to 0400 in console.perms- fixed a few bugs in pam_console- pam_console authentication working
- added /etc/security/console.apps directory- added pam_console files to filelist- upgraded to 0.66, some source cleanups- add patch from Savochkin Andrey Vladimirovich <saw@msu.ru> for umask
  security risk- upgrade to ver 0.65
- build the package out of internal CVS server/sbin/ldconfig/sbin/ldconfig















































































































































































































































































































































































































































�x�������������G�������XZ
2-�?l/-Ћ�������a������5erro�$����������������
5
55
�86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fa6626b2ed07077dda3a3889248a938141edc64c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a8bc88fdbeb6b6c4e01aaf74350720d54b5a2cdb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=cb12116039fb85aeda079a9c2c7bb614945d5267, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9ebda43e62112defaaeadf58f9acc3bd2a83ce24, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0664066ba59b9106b230d4981002234259f020b2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=248e6a897c09236bcca6a662b362b3066c0a738e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2c3f2bd077183616a2c34f7e35890d3c69adb66a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=10646202b65eb888ce9077f9b5582e93154489b3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d07f7c13a24793131dca7bf628a8a73b3b178288, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f840f8f5586c8cb2566fc93b188c6bcd50ead04b, strippedELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=ebd3a2b42658a9d1617288915f76004b9641aded, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3b6fc1df931565507858f169aedaef9fe741452c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ef6c2e4dca0219613e2e12ca1a935cf0f57b4b0c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d47058f506c15d16e1a2c6c4499937549245d1a1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5a856beb73cc79e374759edfa3d4c35122628dad, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1bbe288ced3aedd8861a8311caa6e4929e1894d8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=99b7b97295af7328e85fc7e78d82eb879004bbe8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fbfeb5babe4ab8110424d05df9493fa8678724ef, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a2cc8b92db81ca7da23cfdf621516ad2ba188848, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b7ee6d5ee81f26c327a29df857e501b5c68933e4, strippedELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=a2b806ad7f7b6428afe8d8ebc8857fc9b535de96, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e14bf584fcb1040478192db0cd6a743cfc670f00, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c9b4b863f35c1a51c58130c6d66f82713715630f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ba232eb239508543b126247b27a4c6559e02ea99, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=12c2a970c257495aa4b54a8b8ac019e1f814f053, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2082d705d713dce47206ed2116c1da3e639817ac, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1c702ff848ee3832f0703df4b4ab05b2d0a28c5f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=61a92f31841f52672034cf461427b1ddf700c5ea, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ebf57e5be19b280c1f679d1f60ba5a83305b43f2, strippedEL�x��������������6�������X[
gc�?itch�a������8�
5pm/r�$����������������

555
�=f9bd6c6f4293337908ca988466c1f5a6785cc36c, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d774cda2623fbd957462c2394bf0eb90f4e72dc8, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d1cc6e7d33751f80f2ade9b5dbe1b9ae1d0bea80, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0c1ced86467ac9dde70e9b9ed51a54c311267b6f, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=8328ec0075646d7449c0c0a50abb4e732ab6ff96, strippedELF 64-bit LSB executable, x86-64, version 1 (GNU/Linux), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ab713aa1309511e3903e99a0c7747d8d5eb6be76, strippedBourne-Again shell script, ASCII text executablePerl script text executableELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=21fca4502ddcdba3c8703c5ddaaeaef86cf225be, strippedBourne-Again shell script, ASCII text executable, with very long linesELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0fdc0eb9b050d8d687867cd2e0906599934e4b07, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=51b46b7cb6613724b69a3e2e8bc8c4932e344b8e, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=343d32abada3dcae7971998de6e81a1ee496ab70, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=51962b73786c1c1f0ad0a10b3522ea1c555d2617, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=06bf2476bc17fc42ee1fe1b93b79d70ece2c40af, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=505f3b2b2635659d09e11d58b5d03e036745b1f2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4dff13e2ab3ab335fd58b8c871f245a6c3dd33d6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=66eff003a3058676ec1d39e32b6a0b9456bf52e4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3c99259c2fa76a7df60ec48068c6dfa3ec621d85, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0d0f35eb8f6876eb5e3e7ef4c3f4cf884fec8451, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=80967b41fb431f030c384e9ca1d7aa0b58c99b9d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c6d7d07a38d18029a11b655e86798368157d23c2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b1e7cfb0cec97f3bce10595ff43b16bdab9f8039, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e3b79c2154b774aad69c31b977e08cfbd774985d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f0271afa44736853cfed00189427a20c6e20aded, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6417f5ad5b23288b75c48e64a267655459551174, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=eb3190ab9951952b24a17ce81025dd9470cf492b, strippedELF 64-bit LSB shared object, x�x��������������%�������X\
k.�	?mkh@@�������6������>5am.8�$.����������������
>5=5








		


	






















































































	








	



























	ASCII textPython script, ASCII text executabledirectorypython 3.6 byte-compiledPython script, ASCII text executable, with very long linesASCII text, with very long linesBourne-Again shell script, ASCII text executableASCII text, with CRLF line terminatorsemptyASCII text, with no line terminatorsPython script, UTF-8 Unicode text executablePython script text executable Python script, ASCII text executablePython script, ASCII text executable, with CRLF line terminatorsAlgol 68 source, ASCII textXML 1.0 document, ASCII textUTF-8 Unicode textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8e6020483093d912cac99ab61ed58b33724b36b3, not strippedC source, ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=36365559b751e331fae00d23b75b6cefa80dece1, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2505b3dd54daadc34ac9e201f0ce734499a6250f, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a97e4740717af11fc454a62c9cc0048ea43f0c7d, not strippedg�1Ĩn�+�H6��Wutf-8aeeaffb23ead4e0ee768257c6394c9424e6e646d3caeda65fa3f089c19e90cf1?���@Q�p9i�m�
<��~I]��38844dd6f13c33c1d454a9d21b83fda934bf159da2684f9cbbd5e80f5ac3d313346e34159c2b785a4c89111dd6148fc9c4cd6395g�[
PY@g�Zfor BFD packets (Ivan Vecera) [1857594]
- [netdrv] mlxsw: spectrum: Treat IPv6 link-local SIP as an exception (Ivan Vecera) [1857594]
- [netdrv] mlxsw: spectrum: Share one group for all locally delivered packets (Ivan Vecera) [1857594]
- [netdrv] mlxsw: reg: Move all trap groups under the same enum (Ivan Vecera) [1857594]
- [netdrv] mlxsw: spectrum_trap: Do not hard code "thin" policer identifier (Ivan Vecera) [1857594]
- [netdrv] mlxsw: switchx2: Move SwitchX-2 trap groups out of main enum (Ivan Vecera) [1857594]
- [netdrv] mlxsw: spectrum: Reduce priority of locally delivered packets (Ivan Vecera) [1857594]
- [netdrv] mlxsw: spectrum: Use same trap group for local routes and link-local destination (Ivan Vecera) [1857�x�������������p�������X]
53�?df5a��������������c8dc�$����������������
���
�ulated (#43706)
- pam_securetty: check if the user is the superuser before checking the tty,
  thereby allowing regular users access to services which don't set the
  PAM_TTY item (#39247)
- pam_access: define NIS and link with libnsl (#36864)- link libpam_misc against libpam- pam_chroot: chdir() before chroot()- pam_console: fix logic bug when changing permissions on single
  file and/or lists of files
- pam_console: return the proper error code (reported and patches
  for both from Frederic Crozat)
- change deprecated Copyright: tag in .spec file to License:- console.perms: change js* to js[0-9]*
- include pam_aconf.h in more modules (patches from Harald Welte)- console.perms: add apm_bios to the list of devices the console owner can use
- console.perms: add beep to the list of sound devices- link pam_console_apply statically with libglib (#38891)- pam_access: compare IP addresses with the terminating ".", as documented
  (patch from Carlo Marcelo Arenas Belon, I think) (#16505)- merge up to 0.75
- pam_unix: temporarily ignore SIGCHLD while running the helper
- pam_pwdb: temporarily ignore SIGCHLD while running the helper
- pam_dispatch: default to uncached behavior if the cached chain is empty- correct speling errors in various debug messages and doc files (#33494)- prereq sed, fileutils (used in %post)- remove /dev/dri from console.perms -- XFree86 munges it, so it's outside of
  our control (reminder from Daryll Strauss)
- add /dev/3dfx to console.perms- pam_wheel: make 'trust' and 'deny' work together correctly
- pam_wheel: also check the user's primary gid
- pam_group: also initialize groups when called with PAM_REINITIALIZE_CRED- mention pam_console_apply in the see also section of the pam_console man pages- console.perms: /dev/vc/* should be a regexp, not a glob (thanks to
  Charles Lopes)- console.perms: /dev/cdroms/* should belong to the user, from Douglas
  Gilbert via Tim Waugh- pam_console_apply: muck with devices even if the mount point doesn't exist- pam_console: error out on undefined classes in pam_console config file
- console.perms: actually change the permissions on the new device classes
- pam_console: add an fstab= argument, and -f and -c flags to pam_console_apply
- pam_console: use g_log instead of g_critical when bailing out
- console.perms: logins on /dev/vc/* are also console logins, from Douglas
  Gilbert via Tim Waugh- add pam_console_apply
- /dev/pilot's usually a serial port (or a USB serial port), so revert its
  group to 'uucp' instead of 'tty' in console.perms
- change pam_console's behavior wrt directories -- directories which are
  mount points according to /etc/fstab are taken to be synonymous with
  their device special nodes, and directories which are not mount points
  are ignored- handle errors fork()ing in pam_xauth
- make the "other" config noreplace- user should own the /dev/video directory, not the non-existent /dev/v4l
- tweak pam_limits doc- own /etc/security
- be more descriptive when logging messages from pam_limits
- pam_listfile: remove some debugging code (#28346)- pam_lastlog: don't pass NULL to logwtmp()- pam_listfile: fix argument parser (#27773)
- pam_lastlog: link to libutil- pam_limits: change the documented default config file to reflect the defaults
- pam_limits: you should be able to log in a total of maxlogins times, not
  (maxlogins - 1)
- handle group limits on maxlogins correctly (#25690)- change the pam_xauth default maximum "system user" ID from 499 to 99 (#26343)- refresh the default system-auth file, pam_access is out- actually time out when attempting to lckpwdf() (#25889)
- include time.h in pam_issue (#25923)
- update the default system-auth to the one generated by authconfig 4.1.1
- handle getpw??? and getgr??? failures more gracefully (#26115)
- get rid of some extraneous {set,end}{pw,gr}ent() calls- overhaul pam_stack to account for abstraction libpam now provides- remove pam_radius at request of author- merge to 0.74
- make console.perms match perms set by MAKEDEV, and add some devfs device�x���������������������X^
ha�?obje`��(�������1 (S�$E����������������
���
� right error when
  we're dead but have a lock file - requires initscripts 8.99 (#521772)- if the init script fails to start krb5kdc/kadmind/kpropd because it's already
  running (according to status()), return 0 (part of #521772)- work around a compile problem with new openssl- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rebuild to pick up the current forms of various patches- simplify the man pages patch by only preprocessing the files we care about
  and moving shared configure.in logic into a shared function
- catch the case of ftpd printing file sizes using %i, when they might be
  bigger than an int now- try to merge and clean up all the large file support for ftp and rcp
  - ftpd no longer prints a negative length when sending a large file
    from a 32-bit host- pam_rhosts_auth.so's been gone, use pam_rhosts.so instead- switch buildrequires: and requires: on e2fsprogs-devel into
  buildrequires: and requires: on libss-devel, libcom_err-devel, per
  sandeen on fedora-devel-list- fix a type mismatch in krb5_copy_error_message()
- ftp: fix some odd use of strlen()
- selinux labeling: use selabel_open() family of functions rather than
  matchpathcon(), bail on it if attempting to get the mutex lock fails- compile with %{?_smp_mflags} (Steve Grubb)
- drop the bit where we munge part of the error table header, as it's not
  needed any more- add and own %{_libdir}/krb5/plugins/authdata- update to 1.7
  - no need to work around build issues with ASN1BUF_OMIT_INLINE_FUNCS
  - configure recognizes --enable/--disable-pkinit now
  - configure can take --disable-rpath now
  - no more libdes425, krb524d, krb425.info
  - kadmin/k5srvutil/ktutil are user commands now
  - new kproplog
  - FAST encrypted-challenge plugin is new
- drop static build logic
- drop pam_krb5-specific configuration from the default krb5.conf
- drop only-use-v5 flags being passed to various things started by xinetd
- put %{krb5prefix}/sbin in everyone's path, too (#504525)- add an auth stack to ksu's PAM configuration so that pam_setcred() calls
  won't just fail- make PAM support for ksu also set PAM_RUSER- extend PAM support to ksu: perform account and session management for the
  target user
- pull up and merge James Leddy's changes to also set PAM_RHOST in PAM-aware
  network-facing services- fix a typo in a ksu error message (Marek Mahut)
- "rev" works the way the test suite expects now, so don't disable tests
  that use it- add LSB-style init script info- explicitly run the pdf generation script using sh (part of #225974)- add patches for read overflow and null pointer dereference in the
  implementation of the SPNEGO mechanism (CVE-2009-0844, CVE-2009-0845)
- add patch for attempt to free uninitialized pointer in libkrb5
  (CVE-2009-0846)
- add patch to fix length validation bug in libkrb5 (CVE-2009-0847)
- put the krb5-user .info file into just -workstation and not also
  -workstation-clients- turn off krb4 support (it won't be part of the 1.7 release, but do it now)
- use triggeruns to properly shut down and disable krb524d when -server and
  -workstation-servers gets upgraded, because it's gone now
- move the libraries to /%{_lib}, but leave --libdir alone so that plugins
  get installed and are searched for in the same locations (#473333)
- clean up buildprereq/prereqs, explicit mktemp requires, and add the
  ldconfig for the -server-ldap subpackage (part of #225974)
- escape possible macros in the changelog (part of #225974)
- fixup summary texts (part of #225974)
- take the execute bit off of the protocol docs (part of #225974)
- unflag init scripts as configuration files (part of #225974)
- make the kpropd init script treat 'reload' as 'restart' (part of #225974)- libgssapi_krb5: backport fix for some errors which can occur when
  we fail to set up the server half of a context (CVE-2009-0845)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- rebuild- if we successfully change the user's password during an attempt to get
  ini�x�������������P�����X_
ex�?e.co��(�������ht kr�$N����������������
�h�h�h
�2d5ef80b6b7ec39f9db88501226d5ef59d3e149f65f5ff0307324f8a513aa5828f6c4a8b6e43e0a76af36d4ad9c437bd3149149f65f5ff0307324f8a513aa5828f6c4a8b6e43e0a76af36d4ad9c437bd31493705ab52d9625520a733e7d028b0af8b1b47c60b96fcf8cb9b9085ea3a3c926fbc26a21e75158478b48579e181e06925450c22fd6fe78d47d74494978c878e544ace9f46043a2eb67e09ebb810a4d47de8769e01e775d2d81772c1738b48228a4ace9f46043a2eb67e09ebb810a4d47de8769e01e775d2d81772c1738b48228ae6d10212eaf9b07cf80ecf094e8d468c15b62beba73200a7102220d3aaae82dfe6d10212eaf9b07cf80ecf094e8d468c15b62beba73200a7102220d3aaae82dfdba5a0c56de20a335778e392e7f4abad84efad5c3f282e89bcfa2d4b0b00443fdba5a0c56de20a335778e392e7f4abad84efad5c3f282e89bcfa2d4b0b00443fd07c902b3b401ce7352f9bd23f07e55d10012cbdf3d43fb6072a66ebcc3362996bec198bae50e3d7d2b5880f78a491444911e5ea4fd7a50fb1d58390f2d073eb660e093164ac283a2a1de4787de59e479368c3931f40bfc486748084077c2225660e093164ac283a2a1de4787de59e479368c3931f40bfc486748084077c22251bc462aec907a2990c6606d3fd12eb94fbe68daa6e7d32f4ebdfb981080c45e01bc462aec907a2990c6606d3fd12eb94fbe68daa6e7d32f4ebdfb981080c45e0140642cda5aa9de2772e8835a9202399b5e94adbe7dc515a5d3074e9042d0ae4140642cda5aa9de2772e8835a9202399b5e94adbe7dc515a5d3074e9042d0ae4a8f5fd044868edc34e6b3a857ff9dcd067db4735907978bf59e34ff5f0695ef46258531e610368a5e909f19105485e91bfda4787094c206e92a21e4892887f1217ad014fab42cacadf54392342a3b274cf5f35e0c12ac53471aec635fb6965a517ad014fab42cacadf54392342a3b274cf5f35e0c12ac53471aec635fb6965a5280e8d970875d287bbdb4d234e04dbc115738d3d526b70c8ee4e14de06200601280e8d970875d287bbdb4d234e04dbc115738d3d526b70c8ee4e14de062006017338725337b4c09bed688420d1241d1d4fcb864194de139eff3e54cbdedf31527338725337b4c09bed688420d1241d1d4fcb864194de139eff3e54cbdedf315234bd4ebd7310b6506fea8ded9bd22a6ac57f2c86255681416bf3b4493604998034bd4ebd7310b6506fea8ded9bd22a6ac57f2c86255681416bf3b44936049980f7ce3ebdb15dce67b0ef09d37d66e386e4f8fef85d04f7c457d82cbb53ab919af7ce3ebdb15dce67b0ef09d37d66e386e4f8fef85d04f7c457d82cbb53ab919ae3814f43972c5e99b0e3c0f3e140371d3194d5c05c80a4ec16ea461eeaa4f71be3814f43972c5e99b0e3c0f3e140371d3194d5c05c80a4ec16ea461eeaa4f71b419ea71d41eecc150225ae4fdf63a9a2b94b289181f9b0af2f6b8f2236248170419ea71d41eecc150225ae4fdf63a9a2b94b289181f9b0af2f6b8f223624817026bdb2c52c3b3006253e6fda745e4430f98163ad3c429063563980e086565ca526bdb2c52c3b3006253e6fda745e4430f98163ad3c429063563980e086565ca562f5c89a487d19eac8688ace9af32ddce4c4ccce40f41d011057aa1a62fd9e9862f5c89a487d19eac8688ace9af32ddce4c4ccce40f41d011057aa1a62fd9e985b0211f1828694fa437f668b696a6668773c1b97f5a4cebe15699635f96ba2c82b71a0dd8850205b9585347a4b2f9981c9d43e46b996794f2d9a252814ef9b2c2a3a44d2ccff483207bf77e965c2102beb02909cfe4ab0ba1a6ba0e9bf4d91cf450f61f019925695ca250493de2fdbfec9b4f7767e6825db7cc04433622b23e407b9744e7cc219bfb49cb966eab4b4d2358b9288c04b05667615b6c39433fc09ffa773de5a41d6d636d342f128f2cceea8304c271e38c81a58517e8d6dbea66d6d0f5a06bfb96523bef5f1ac1ac0cbcf49a79c5b5e1d46677ed54b921bc70ead3c2440676c589eac84a1fec414db69298974b19cd3d2a74a50d4c7dec51d3ea9c96c9869a4bd177a3d25b21cce7d3ae00e60d42e7f5222910f119a4ea61bb4b1c0a6cec36fea52f703b62da5666b716c39986f9e3200089b131cd722f4e8cfe0e6dea439fadd8002d3f8fde882cb3a3c5f64f8b7b27acb9ec9cba4ddd5326672cb5b5c050a64e58911e004a79a821c55f3f81632f13eafc860cf717d40479d74ddbe58dedfdb97fcd94429269468b78a0bd1cdef6839ac5df9d55fdb0d4504e76b4119a4bfc0f3ae8a11d86271319bbb20ff4d8975b3291fcddaeb8becdacd3e6cc81e21e4625f34380c018f575df6f24723c108c78ce594e059e00162d5efc4d759b17f40a1d7636cb98c12f0f1f05c146fca1ebbd5000ce1c4d187b7a9cc6d503d2b119ebceb599362121dcdcb2a2a7525f0fa33a1c5d697d5414355535a77c652db8d6ac1d35b4a0b4fa195590e2a48923dbccc9a5d9e38fb49fee7029db14b38d970ec45ef3745513e3b66fda7ec03371fc9280f2b3fd0ea52fa7f6021f76c794c9b5aa605b49d6a14ce4fcc3a52103e120790233ee9e9c0fea8e6ae6a22728e42d44908ecfd06193e93ab3f93d92223d8b0494d95d810ba666a8e9de0a4cdaed00817108a628aae259ca0271b8713e3533df481207be33b932f8ef1a4fea1b0d37b60665add8f96714f65987b7b42d6bde984b1b0823bd33386b4d98e6f353583cb1fa08c317eb717f874ee7beececb3b31d5a0a47432adf7ac5c5a46bf31e�x��������������������X`
?�Rh�)C�$9����������������
)C(C
�C�?�4d
�
�
�
�	$
�	X
��
��
��
��
�
1
�
5
�	
A
�
^
�
r
�
x

�
�	
�

�
�
$.8
`h�Y(�
8�
�9
(
�:bA
�G��H��I�X�Y�\�H]�P^�db�
d�
e�
f�
l�
t� u�(v�0���
���
���
���
��0


�D

�H
�X6

�

�
��

��
g�
h�
Cphp73-php-intl7.3.3311.el8.remiInternationalization extension for PHP applicationsThe php73-php-intl package contains a dynamic shared object that will add
support for using the ICU library to PHP.d�	�builder.remirepo.net��Remi's RPM repository <https://rpms.remirepo.net/> #StandWithUkrainePHPRemi ColletSystem Environment/Librarieshttp://www.php.net/linuxx86_64.�h����d��d��87d03fd0c378aca33fb7c3f071383ad66eba282847dc60c5cc9a341a4506f2a63c2953596eb8f2343326ad72d6c7cd04f45af917c7c45bf2dd0bf4aa90378b41rootrootrootrootphp73-php-7.3.33-11.el8.remi.src.rpm��������config(php73-php-intl)php73-php-intlphp73-php-intl(x86-64)@@@@@@@@@@@@@@@@







@config(php73-php-intl)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libicudata.so.69()(64bit)libicui18n.so.69()(64bit)libicuio.so.69()(64bit)libicuuc.so.69()(64bit)libm.so.6()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(CXXABI_1.3.8)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)php73-php-common(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)7.3.33-11.el8.remi7.3.33-11.el8.remi3.0.4-14.6.0-14.0-15.2-14.14.3d��d���d�q@c�w�c�R@cV~@c2�b�=�b!�a��@aw�ap�aI�@a$�@`�@`���`���`n�@`>�`�@_�T�_إ@_���_���_��_��_���_s!�_`��_N7�_;�_)M�_�_c�^��^��^�y�^��^���^��^���^�0�^p��^^F�^K�^9\�^&�^r�]��@]�N@]��@]µ�]��@]�z@]�@]x�]w�@]fl�]Z�@]@1@]-�@]��]��]G@]u@]�@]��\���\�]@\�"�\�@\ڭ�\Ɋ@\Ɋ@\��\�C@\��@\�N�\�|�\��\~d�\o�@\k�\j�@\\�\Yz�\G�\@n@\?�\4��\�@\l@[�@[�@[�0�[�
@[��@[�#@[��@[�"@[�9@[�9@[ug@[M�@[;e@[+�@[(�@[@[�[W�Z�z@Z�(�Z�@Z��Z�l�Z�2@Z�`@Z��@Z�<�Z���Z�$�Z�$�Zp^@Z]�@ZL�ZF.@Z1@ZO�Z
�@Y�+@Y�B@Yܶ@Y��@Y�A@Y��Y�o@Y��Y��@Y�W@Y��Y��@Y��Y��@Y�m@Y�m@Ym�@Yd��Y[�@YI@Y6�@Y1S@Y,
@Y,
@Y�Y
��X�:@X��X��@X�P@X��@X•@X�f@X�B�X�@X��XX�XX�XX�Xn5@Xa@X@�X#�X��X�@W��@W�@W�;�W�@W��W��@W|�Wu	�Wj}�Wj}�WX�WE��W4p@W!�@W ��W�@W�@V���V�J�V��V��VŲ@V��V�T@V�T@V�v�V�
�V�VqR@Vh�V`.�V]��V\:@VU��VD@VC-�V0��V$�@VC�V�@V�U���U�Y�U�U�d@U���U���U��U���U�a@Uyx@Uv�@Um��UhT�Uc�UY�@UW1@U?v@U?v@U>$�U2G@U/�@U��U�@U�@U�@U�@U
�@T�9�T��@T���T�C@T��T�p@T�5�Tw@Tu��Th��Td�@TV�T?�@T.��Tk@S��S��Sr	@S,)�S?�S��R�@R��@R��@R�R�R�R�R_�@R:�@R��Q��@Q�Y@Q�Y@Q��Q��Q��@Q��@Q��Qy�Qf��Q@j@P��@PѬ@P��P�@P�@P�*�P��@P��@P�)�P�)�P���P���P���P���P���P�5@P{��Px@Pl(�Pj�@Pi��Pi��Pe�@P`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>�x�������������@�������Xa
3�?Dv� ������X�����֐D\���$F����������������
֐Րא
�, and enabled in all- Get rid of the "warning: Installed (but unpackaged) file(s) found:"
  Some generated files aren't needed in RPMs:
  - the "sql-bench/" subdirectory
  Some files were missing:
  - /usr/share/aclocal/mysql.m4  ("devel" subpackage)
  - Manual "mysqlbug" ("server" subpackage)
  - Program "innochecksum" and its manual ("server" subpackage)
  - Manual "mysql_find_rows" ("client" subpackage)
  - Script "mysql_upgrade_shell" ("client" subpackage)
  - Program "ndb_cpcd" and its manual ("ndb-extra" subpackage)
  - Manuals "ndb_mgm" + "ndb_restore" ("ndb-tools" subpackage)- Made the "Federated" storage engine an option
- Made the "Cluster" storage engine and sub packages an option- Add the man pages for "ndbd" and "ndb_mgmd".- Require a manual upgrade if the alread-installed mysql-server is
  from another vendor, or is of a different major version.- "ndb_size.tmpl" is not needed any more,
  "man1/mysql_install_db.1" lacked the trailing '*'.- Removed man page for "mysql_create_system_tables"- Add debug server.- Remove Max RPMs; the server RPMs contain a mysqld compiled with all
  features that previously only were built into Max.- Add several man pages for NDB which are now created.- Put back "libmygcc.a", found no real reason it was removed.

- Add CFLAGS to gcc call with --print-libgcc-file, to make sure the
  correct "libgcc.a" path is returned for the 32/64 bit architecture.- Fix the move of "mysqlmanager" to section 8: Directory name was wrong.- Include the new man pages for "my_print_defaults" and "mysql_tzinfo_to_sql"
  in the server RPM.
- The "mysqlmanager" man page got moved from section 1 to 8.- Call "make install" using "benchdir_root=%{_datadir}",
  because that is affecting the regression test suite as well.- Explicitly note that the "MySQL-shared" RPMs (as built by MySQL AB)
  replace "mysql-shared" (as distributed by SuSE) to allow easy upgrading
  (bug#22081).- Add "--with-partition" t 2006 Joerg Bruehe <joerg@mysql.com>

- Use the Perl script to run the tests, because it will automatically check
  whether the server is configured with SSL.- move "mysqldumpslow" from the client RPM to the server RPM (bug#20216)

- Revert all previous attempts to call "mysql_upgrade" during RPM upgrade,
  there are some more aspects which need to be solved before this is possible.
  For now, just ensure the binary "mysql_upgrade" is delivered and installysql.com>

- To run "mysql_upgrade", we need a running server;
  start it in isolation and skip password checks.- Always compile for PIC, position independent code.- Use character set "all" when compiling with Cluster, to make Cluster
  nodes independent on the character set directory, and the problem
  that two RPM sub packages both wants to install this directory.- Use "./libtool --mode=execute" instead of searching for the
  executable in current directory and ".libs".- Install and run "mysql_upgrade"- Remove sql-bench, and MySQL-bench RPM (will be built as an independent
  project from the mysql-bench repository)- Remove old mysqltestmanager and related programs- Set $LDFLAGS from $MYSQL_BUILD_LDFLAGS- Changed product name from "Community Edition" to "Community Server"- Fast mutexes is now disabled by default, but should be
  used in Linux builds.- Reintroduced a max build
- Limited testing of 'debug' and 'max' servers
- Berkeley DB only in 'max'- Use "-i" on "make test-force";
  this is essential for later evaluation of this log file.- Pass '-static' to libtool, link static with our own libraries, dynamic
  with system libraries.  Link with the bundled zlib.- Modified RPM spec to match new 5.1 debug+max combined community packaging.- Added "client/mysqlslap"- Added zlib to the list of (static) libraries installed
- Added check against libtool wierdness (WRT: sql/mysqld || sql/.libs/mysqld)
- Compile MySQL with bundled zlib
- Fixed %packager name to "MySQL Production Engineering Team"- Avoid using the "bundled" zlib on "shared" builds:
  As it is not installed (on the build system), this gives dependen�x���������������������Xb
re�?.com��P������h Pop�$v����������������
�h�h�h
�ete old versions of python-setuptools-devel- Move easy_install back into the main package as the needed files have been
  moved from python-devel to the main python package.
- Update to 0.6.7 bugfix.- Upstream bugfix release.- First build from the distribute codebase -- distribute-0.6.4.
- Remove svn patch as upstream has chosen to go with an easier change for now.- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Apply SVN-1.6 versioning patch (rhbz #511021)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild












































































































































































































































































































		
!!#$%%''))++-./01234567899;<=>?@ABCDEFGHIJKKMMOPQQSSUUWXYY[[]^__aacceeggiiklmmooqqssuuwwyy{{}}��������������������������������������������������������������������������������������������������������������������������������










	
























 
!
"
#
$
%
&
'
(
)
*
+��39.2.0-9.el8_1039.2.039.2.0

		

















�x������������� ��������Xc
em�	?rsp ��������(������:5epor�$*����������������
:595;5
�irtualenv/lib/python3.6/site-packages/pip/_internal/models//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/network//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/operations//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/operations/build//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/operations/install//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/req//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/resolution//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/resolution/legacy//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/resolution/resolvelib//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/utils//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/vcs//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/cachecontrol//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/cachecontrol/caches//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/certifi//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/chardet//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/chardet/cli//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/chardet/metadata//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/colorama//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/distlib//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/distlib/_backport//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/html5lib//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/html5lib/_trie//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/html5lib/filters//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/html5lib/treeadapters//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/html5lib/treebuilders//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/html5lib/treewalkers//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/idna//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/msgpack//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/packaging//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/pep517//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/pep517/in_process//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/pkg_resources//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/platformdirs//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/progress//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/requests//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/resolvelib//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/resolvelib/compat//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/tenacity//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/tomli//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/urllib3//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/urllib3/contrib//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/urllib3/contrib/_securetransport//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/urllib3/packages//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/urllib3/packages/backports//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/urllib3/packages/ssl_match_hostname//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/urllib3/util//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_vendor/webencodings//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pkg_�x����������������������Xd
C1i?pdat����������������/www�$}����������������
������
�68479e7b085a16892c97ddd0de3c1727242523b6bb41e08b0a5f12d35e3f40554e396d040cf66e0ed93c3dc7d0a093393d49832106575bb162bff8c6780a5ce94132f19859acee841fb26533b5d0f231f7edcc7352d7734a96eef0b8030f77982678c516876fcb81e25b32d68564c5f9f162e35c2db51cf0eb3bddec578b73aa3959351c38f0d94b5fa5ab85333bf074e68985dc40c5d5c9836f2b0d88ab09365a788339ef0b9bc4c709926f995eea2bc8a423afb4a676fa6946bc069b093a647e953eee2fab2f2eea0b56650479749e8eeeb3c33778d4e94a7d8d9e25d5a01d2f3cf6bce7c4f441f39c70d73e7ec64dd6ede0dad502e014144cdab3c5a58457bb1a9459f2745a6ff387fb03a3b89eef9a7da5bf0d5de481caa0407b2568b531b7b8aefc28b77b35ffc2e3cc6d7039c038e68487357ddd22c108a28315b3507d89cea8cc4311a57405e282afaf06acfe7ffde54acf36391d191885286ffc89b7c5230b589da688631aa4f534a142a464d1ade96d9833a09565eeddf8d3095634d80e977149edb6e0db6338daad677e3c1e150ae9a64d9b1970994351494dc1a9e4675e00ebd9d28978450225b18686e96b4265527a7e308d57a21827eaa7c137c082ce57ecf118d7a5cc6d95ff50b0e5011622cbb364d29bea83b00fa955d7d1f5b152fb2d8f5236fb537239c7abdbe6f190a883bbfc0761a9b950de940f4efdf4b3cd94c32ee7d9702aaa03e19c5ea1e30055be506303e838c1f538644788be3faf0be85f82b2b996c87e2b3d24193a1eb6a35918d87b812fef582f9599e95f964f7759427f2af09b1c717ace2c22295d7fb336f61a605c956f043406bce0c5fa103484035eede51227fefaeea49600ba2a9f750196f54b365e288ac768f590af0a8b59b48a3f37e42179427a8eb9ec5c645df124b213ebc82300ccda77d34a00b17b053d57d4a341514f3e16b37d4aff55cee18cdcdb3830681fff16da145100baf7500cda3455a84b4940b20e3a010f419744a1918dae2b8247392760ad4adc5dffb5f84d0fb4f30edbb07ae728539e5c50364ab60b5df4cc87ec5f15150cb9740dda7e0927570f2423c53a1147cacda3d84af87b2074233df65986eac662353ad8e76133f08ab63301a55c5e708048ed140904879bfb5e6bd05bfadf88240b8d56dcbb6301b97f26a04e9682908b7a2033da1c84a46f0ca3ad8f7fea6e81d774a302f8a5c2f645dc68db6c4a13ec4ae4675848beebde1f8c53e9beaf6f985a708e49ab24efa41c8c464b13fd2779f5b5468ba6ec24529f51e1b974e70144c04050e6a56ff1ba2a73ee438d461bf1444a1d5d1ba7d67a8e30b10ff1c739ba65baf3aeb2b39493a45bd8f844fb847dc02a95913e911eae0045fefd7bc983f0ff6f63be55bf63d8ad0aa121ce7424d0282f2575a4cf844fd7321f78d6f3f9938c295013d4aa552ba3cb4962c634b8686e3456b70894b6764899449f127387464a3e0cad12dce66cfe33f08636cf97c737077cf24f4f564846782aeef4be846dd22e2ee994563480cb2c70f159f821803981a3c69d1b98048c7556015e94b648489de01bcbea431afe34b3bd4b31fb253240bc1084ad74fbbdea92e1dff7667bfc3b28b459bb33160f0939965b50331d177f125bdb1e43a4e8531d18ffd2c74ff6b77c81e834e594d77a335d4e6426079bb73ffaea4a21a0564d1bd96541c9b9529342b14a0c07e63a749b155997778364f766daca727ab885a011c2fec748e8cefad054f4c85cf2cf1b28be48e9f03dab842931c671b9202de185cddfa17132d3e313cea0458c92858d744eb3eab1c44709b5e8a17f47a64a94f504ff0fa04f62c4860ab1d8bcf93b9072731bf735039274a43e54747c84b47d2f6e51606596f34694a9ef70cead036f92df908f858c08b91319163c615e9cbb4257f0a192270580807adca4aef6ba2732f873ac9a7b31ec786fe4836421cf33cd3f1c882a900095ed67dfdeefe52ef710ee52fd70c0cd0e4c842be91894d8aa83bf54cc7ea22a82c7cd8bb6c2351634370c13a041748163f06f121c65e6d8b6e7db1881b091cd2802a54c480e234508889e8932d7e30c9b9cf62c0cec77cd9daccf75cbc8c2cd3bfbda74617e2d96dfb0b9e6e6dd7cb6b514ef65525325f21d2ef6e3723d070ef975bfa9be96e4e34d102ef8ffa57221ad45636fa6688cdfe37583c7037ec7b0307653b28c8fd9da547af9324a771edfaf8f11b5959db7fef5feb8f0faed08f308e12ec43fd4a8690a0b4c8312584a7e60c7bcd6634548a9a761d06b0ee32e99090edb672a2269dcd48761d1d9c7e54ebd450cf3b8acb3b680826f05dce37667ff8de07dc2457329518f30701fa898c645f086790910759303bb333bd18b2d850623018d8eee404eefef66c2d0b14d6d90d0f25e5090539f5c5077c399eafc926d2351f1957466de7884090aa90782563d84718112a1374c6c38f0893ef92f8f04eb071feb12d3bda27c5baafb2176ed0a01a836091d428a7fe7dc64cd283a819a4b54a1370f037114c3e4f06db0203141c5cf7bf48b39efa550b3980bc42441088c4d5797249d99c5947f9bc441ed69ea2058f6a167731c191b6e410e04853886927b4efc8ed8f2679bae129a37804e427f41ef5a91801f7fc4b1145a08fd136e772bf5640047b77963b4dde147a4bd1dd85847e948569841403403e6a4fbd629fef7c941abbfa102686736a720c030bad893c18139f80a67c06c32780a0fd65972c59099c246db157ec8ddb30f3e28af8e4ba824c0e0831ac5067724b903d9a03c2ad2f87fecdf0fcd82153ac327da19f3�x�������������p��������Xe
+h�?ame"ȥp��������Hostn�$9����������������
�H�H�H
�p.sopam_group.sopam_issue.sopam_keyinit.sopam_lastlog.sopam_limits.sopam_listfile.sopam_localuser.sopam_loginuid.sopam_mail.sopam_mkhomedir.sopam_motd.sopam_namespace.sopam_nologin.sopam_permit.sopam_postgresok.sopam_pwhistory.sopam_rhosts.sopam_rootok.sopam_securetty.sopam_selinux.sopam_selinux_permit.sopam_sepermit.sopam_shells.sopam_stress.sopam_succeed_if.sopam_time.sopam_timestamp.sopam_tty_audit.sopam_umask.sopam_unix.sopam_unix_acct.sopam_unix_auth.sopam_unix_passwd.sopam_unix_session.sopam_userdb.sopam_usertype.sopam_warn.sopam_wheel.sopam_xauth.sofaillockmkhomedir_helperpam_console_applypam_timestamp_checkpwhistory_helperunix_chkpwdunix_updatepamLinux-PAM_SAG.txthtmlLinux-PAM_SAG.htmlsag-author.htmlsag-configuration-directory.htmlsag-configuration-example.htmlsag-configuration-file.htmlsag-configuration.htmlsag-copyright.htmlsag-introduction.htmlsag-module-reference.htmlsag-overview.htmlsag-pam_access.htmlsag-pam_cracklib.htmlsag-pam_debug.htmlsag-pam_deny.htmlsag-pam_echo.htmlsag-pam_env.htmlsag-pam_exec.htmlsag-pam_faildelay.htmlsag-pam_filter.htmlsag-pam_ftp.htmlsag-pam_group.htmlsag-pam_issue.htmlsag-pam_keyinit.htmlsag-pam_lastlog.htmlsag-pam_limits.htmlsag-pam_listfile.htmlsag-pam_localuser.htmlsag-pam_loginuid.htmlsag-pam_mail.htmlsag-pam_mkhomedir.htmlsag-pam_motd.htmlsag-pam_namespace.htmlsag-pam_nologin.htmlsag-pam_permit.htmlsag-pam_pwhistory.htmlsag-pam_rhosts.htmlsag-pam_rootok.htmlsag-pam_securetty.htmlsag-pam_selinux.htmlsag-pam_shells.htmlsag-pam_succeed_if.htmlsag-pam_time.htmlsag-pam_timestamp.htmlsag-pam_umask.htmlsag-pam_unix.htmlsag-pam_userdb.htmlsag-pam_warn.htmlsag-pam_wheel.htmlsag-pam_xauth.htmlsag-security-issues-other.htmlsag-security-issues-wrong.htmlsag-security-issues.htmlsag-see-also.htmlsag-text-conventions.htmltxtsREADME.pam_accessREADME.pam_chrootREADME.pam_consoleREADME.pam_cracklibREADME.pam_debugREADME.pam_denyREADME.pam_echoREADME.pam_envREADME.pam_execREADME.pam_faildelayREADME.pam_faillockREADME.pam_filterREADME.pam_ftpREADME.pam_groupREADME.pam_issueREADME.pam_keyinitREADME.pam_lastlogREADME.pam_limitsREADME.pam_listfileREADME.pam_localuserREADME.pam_loginuidREADME.pam_mailREADME.pam_mkhomedirREADME.pam_motdREADME.pam_namespaceREADME.pam_nologinREADME.pam_permitREADME.pam_postgresokREADME.pam_pwhistoryREADME.pam_rhostsREADME.pam_rootokREADME.pam_securettyREADME.pam_selinuxREADME.pam_sepermitREADME.pam_shellsREADME.pam_stressREADME.pam_succeed_ifREADME.pam_timeREADME.pam_timestampREADME.pam_tty_auditREADME.pam_umaskREADME.pam_unixREADME.pam_userdbREADME.pam_usertypeREADME.pam_warnREADME.pam_wheelREADME.pam_xauthpamCopyrightgpl-2.0.txtLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moLinux-PAM.moaccess.conf.5.gzconfig-�x��������������������Xf
.0�	?emi (������P�������"5o.ne�$2����������������
"5!5#5
�6202abae74043e28f586f314018063264ba990bc17cd4343b8965b2267ac737004a6ba0e463df8172ad7a0ef0445085f83ce59003c8da29476e430adbe242e3d17e00948f7cb31c86e65bb092f8829027df8f3d07ff60a3bc10e01ecbfacc5b4511eeeb469d6657206073f52501ca7a3376add6c909057479278dcd6b0453bd6da0fd76080e1b29b28bc1405f2a2b5b551fb8e1685ee771d6c889c85449434109e20095f138846d0ac9320c92a8e96528d797e6d32ff2796e2918cd8f98fd872cd2eb1d150a287653403f529e522e21b46765e53244bca2f92d68ac09b98535ec314698e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8556c36f2384856d8228b25c42a00a032ac41cdf9a925b321c52aaeaf17c645b269e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855791cb5323fb0a60eec47af8e4af9d25788d46e3313e3ae1d2cdfc25b16c8455c076241076fcd44fd36c4ae8309ad4f6bd22ec6b3f0c730f365b8b14246fb53d395fce91c598988ef36b210a52c49b7401eb64988075a78e964e1ffd89854e5377a3f601af7c06f61add3495a7c5a78e52228473f90c2b438582866ea042602530c3e29227bffdce10419f7c41729c1a22adcf25751efcf6c2e61922ae9330341e2a50aa3b3d457ebd522a5e6af6043fac1fbaa9941f75f23883e5e36c448f6f56918bd7965e8f5911bf795d4c5e7f8676d421659e78db122028f473ac7a832ded0c9e7a372874cd7d745f63beb7f0db9f38f9146fa9973a6f8baa3fb8c76c3c092f2c30a0fc9987d652e3514118fc52d2f14858ee106f0cfb951136d8f2676b3e5bfeaaa04475652fbb8bb5d018073061f861e653901f255b7fd8dd174b73de687804b843e2d2da071d5a75a0ed2977eea6c82a634c162d76ff7f5ff256557a0e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8559dbcedde2d1a80f54fd3b8eaaa08e16988cc9ae022fd6e44d04cb0662bd53bc1d4b556ee58ea462ac595f1318f097ebf507bbd20143539b318cb3ea9acacdb386553300a41f1fa9cbc111b31c4cdc897e322444664b55fbc88b06609f4511c8ee9d67eab4ef883b5e1b09dbb3050a091cb7c895359077b0c66f2a17fe294572dc21ce55fa51312038330e0b2d190cc50e351042cf9c3220cf19f68a57018f8b9645488a97d02e968b38b179c0a1677fe8932bbb044bf4959bb5553d2cea1e123846846061ed3904921fc8420e42d56ff1b8f36b8082afe415173f213eab42ee12449929a6aaa2f26b0f0fe75814226661f06c20f62d7349ef83a2a022b67da772b29233485f351913378a10ea65e71bcab3a22c1125cff68f5e4eb8c4d16fd8bcd4bcf3c226ba7a74e17437818055b39c97aa3ee2e5ca4ab1a24e492be6f512e9d1817f3f797fbf564bf1a17d3de905a8cfc3ecd101d4004c482c263fecf9dc3367cda10a4353dabb0e4c14c57a1e68043072137f402e6bd7d0bb38b6b99cc67189a60dc4822f6a6895d1c01879c2ff8c36e4566a7e4122ee34a117a8c563f6fb4e59f6692ecb9ced56e4e675a933090774ca170a9f74200bc7e31b6348346a45f8f80a96f756983e13f1ebec5b7faeb21c540a6eaa9f0bfe59b785a42d7d47717f52770e5c671cf8c81e5854c0d47e100adfd144d41745b17aa278dedd2c8764126c150d381f7287a0270e7eb54ab2d0d21839a33d08f7eb97106f75009b88841513371b1e2a5b5f2096c07e91e0ae1347e37c4f82cce795843303544c198b1dcc50a452014243076b60728eea454b245b4cd7180598bd1444e10d7feb194bbbeec7d4e0737a524596675f3f53343767e75e0d7640dd9dbf903c2d0b08790aea8e04922e3f2ff8072607e96fdb360245faa610d83a14f9d2ac0eee724560978e003bf2b14dd76a1adacbf67b3b9003e36f409c37ac6c088c5b2b7ec763daf7119821ecb09e968b9cfd064a273c2c55a0774515bcefe5d4d73a62817ef3b47fe3ad18bca384d6357ef916d46bcb27f155f59a2a0bd027ca3afbab79314dbccdbc8ea9649d9a9cad19f52087f67a258803361a1cf81007cb279e4f5e45af8dad310156fbcf4539ff788a73e5ee50ced48276b317ed0c1ded53fddd14a82256762b809cfabc16c4d71c01071562bb514f4085d363138a394a47e4f02c9f6f3b4efe3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8553227af504bafde5fe6408487e52174b210e4fc13611c7cd88803eb4f72133782208447a4eb099494a0923ab5528781a0c4ea86f369de037d17231be4a7fc125e6fd2a4e4c17b2b18612e07039a2516ba437e2dab561713dd36e8348e83e11d295dc6e25c1faa723bf76dca21a7a37df1332938fe3f8f79be88e03ca6d2b61966cf9c9e1b5ca038fc78b94c8b76a8fea7c0e4e5405be47fdbd0d2235bdca8f2804cc8808056dd50e3e621f0c87e21dcdca161489f24323a1fd904b923ed8dc90f80548aa014dbd2c283c35bff6a9272d7994faf4bf6984bee1247e8a13b5c5b1eb89e1c8f09b7fe7adf1c92c270653d993e5ac3c4977f0f2fd5a0540fb385b95b319f9f61c34bdeeee936bb7eea0d8440eec06d15e48dcf923c46305cc41b2e67bc6c9b01441894f28c72e9335ffd9eeb97e669f9c516e31b0f6e676984c4c2d77498de6addc14be4d89f546b505570b9f50c6ac6edccb7d8468cbf1d710d7854fdf2d136b16bc5870755fca8f2f93d8fcb3a24cf0dff1b12c5516be91272728fb66ae9fa5bbea8ed62ef9�x�������������`p�������Xg
de�?obi�'�������
5pyo�$����������������
5�4
5
�
	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`aaa`aaaaaa`ab`aaaaaaaa`cccccccccccccccccccccccccdd___ASCII textcannot open `/mnt/workspace/percona-server-5.7-redhat-binary-rocks-new/label_exp/min-centos-8-x64/test/rpmbuild/BUILDROOT/Percona-Server-57-5.7.32-35.1.el8.x86_64/etc/my.cnf' (No such file or directory)directoryELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=66f0b7c40ec5de5f1787637ad5ea18065c6f0aa2, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f26e6af5cb14c7520a4d71e6663565c72ea86075, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=999206498f5c349b825b5195683b36addbb37e62, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2983a1bd8331d49dfb5b4f0422cc7547b8e9a8e7, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3887b0695a4592da3097fd8a9aa257d07e042103, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=80e95feda5ef20690031ab02757d1b23bed3d89c, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7cd85a2d480cdf294f3e364d14b15e6410fe3503, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]�x��������������_�������Xh
�?	6��������P{�������4�$`����������������
�4�4�4
�880d3ac0021347e039710aae5395ecd6a8a6c423b962d72c077dedc138b274c7865eb0af62ce1ae651e980006f2e9d29bd2f24e1cd18c6a0b1914e9c437cc80e990ab523f528ccf72151fd25636fbf264790ddf68df4438f5b4c43384650e168e5c4b58aad65219b2ab97fde33abdcf57b5c421f2370fdee17d29cd2316b07dd81da993e6bda3b234253ef3336cc8bdd7a253b267b7412a23bb8d805d5e33d640c0cc3d73576120981f9a1e71e1721d34aa13c1cdff2f1af643c40b4abf0b816a2560789ccabe99f7e138202f8c9e89714fe1f5723c579b0302ee19cd73e8d04b14cee675ab2163a800cbebb6134521e3eded9edca91de3aca3bd1949e2fcc6bfb0bcfbc5c131c6bdcab7d06dda9856eb3a65cc2131d992f8c643c9fc50489a7fd5b4f9a76d8bbd0177bafdbe9f0bae8bc8545ef9a8cab8c5f8b93037bef20693354138e595c5905ea36daa97bd7a83a2dfc44b4b2dfdb632cb5853175f4e7067642b14bebf55693ebad9a8e008e0a12c0da56b48b23cedf91269e695417191f77f9ff01e5f9dae51c7b837051fe74bac499f19ce9aa0b6549a444594866f83a0e1439b5d2c21897dc102825d1bd0373f5703e1c5aadc19f72881f7ad4783beba6a20580bb2ea67980b576d2b1ffaa12f4ab185aaa13aabb149e50adb885be935bf42e35546dc3876d49ee40d977dc8ede91d44019ad0b88ee43eb71581083a1a510b4bc718d4f5579e11449b26dc1066aea692a63c1fbafb8b18b9d98cc28c1931d331f1e557b6f4026e13d128f9f8b173933d5fb89823da7259293ab2b68469d334acc781647f4bd297373cd2a25b1036386ff95211fd1797a299985768e5fcab9e17b54205d1f5713ddeacaa48c5884ea76c2c8daf73935ed6b62cea2b2c53eec273ffc7c027618f6d35f94feca837a3e184a0363d932a23e4497ab70a02f2e3cfb3aad4e3bd6533c7a56a70cfe2ce560689eb4111d9017427db74b7700f3216beb569537e7bdd66bbc5fb201b3b0e8e7e48c80017326a688dd778e1fdb4817c05c2df9a28762e6d2143399bda5e1531578390733120b76332517e3dad22ae537283ba8aa04870c59bdf83b223103bbb106ced3a5ee11039e6c9a09d6dc3e2b7f97f182d7aef65ad3f62c114845eecca6ec763754bd4547f9eec3bf0488fd6a87f439a614b8e81fbd6ef9564ae3edc7a4a5e9e334d541b38818badebc5f81dc8075f28fdbceabc27ee81f1b401e9b06e63a482905ac70d9b1fc1a628283f7b9c96d031a0f90d77595abe02112adf69a86560e3168ba379fd450176a8e070763077df4645fb5e5830b5570efff3afea8595aff3beee6337783bfbcba83170559ad4d0adb818441806595aeb0fa3d2b6c1849623725784f70ced76b6928b44210bf2170cc609b5878385d852d0ea5954c258eafff398462f921463ea04d0e749840a53c2d4f66d921018d7a6c7133c5c95f005fc510b95ebfd4f09b62fd96fbbaaac1ca5c9e2da70b5a91c9c722584367d72db2eb8f1e4ffc1dcbb7bc3665319c25e03fbaf29f48e125a924b98071e049d807037e0dd0dd4c6ff11d50e1dbc52fa7bdfaf351df9145bc0163383930433667b7396832d23becace77a0839ccd031aa92fb202e17ba92bdd0659b41c2464395783811a2f6a3538cb14e6fcb1397760e996452b57266d75e300e9448c197a995f81a7bb52c50ad80bf9c6896224535099a9f848f907b99799a434f3ea12b34bc8f2e86c9efbefb8bfccc145326d34e00a81c4a30dc9eea15a8babe5f106b21a25c0f8cde70a588c350e4ba27064cd8fbae0397ee17db0841a371ae875808e8238d3f604f0aa25958c569569c7ca1ef86f236d41d5f824643489c4f9ce2170bc38ca39b32bb7efcc0e9157dafecf278c6546d1b8fa5b54433476717c596866970941d9f3fd7e251f42a65ae5bebece7c0dc1a9bb09d1872706da59ef362a9b69fcc04d9ed961f876a735b00d85199bbe9c7beb572566b330a057ca9d16e978b7c8fda07e3113a0ed73fd2629b8dbaf5d783436cdfd0970e214826c7a84bb85e2f5c619e1e465cc33ca5ac3c3e3172a55698ce1b7d78831b21b520dce21adf8d9038104c78fd4f70d24b1133205cbd2c03ed06e4d109c826d79eae7c280418e860433877c238f274aff63df5858460b221fbf24d62865e15164a208bddf81abb61c35fb429b4186bebf360b3996fab592514bbf69878ddc4c5ae84615556f0ec1025bed972ac73a758dc1f211b27f5c6f5f99c372a216f17160204e425c2d4b2e206d1d2b9bd0fcb46b397fed18e518a90169495e178f3de53d371897c7aee8fc5442d88c89412b6c2ba8318e4a78f0a2cb89d9f9df5885d3fc52b05d47013b8b8be0c4d40dc820f21e748e38b4919d9e681bde97d5155778aef90b37d697943c433b88835cbbf10805803f66cfc13a9d47ac7ac2c3ee66d19fa707af7558afdb584f59fd7cb39e66ee5a0946a599f2a51090c81c232f80fbab88e58daacb7bf7b6a4ece30ab17a2743560780b4a409ec29e485a84b0189bed63cad95c4567309872d8cb5003ca3df581989bd4237bc66285efd3b9e1d940d8be56ef9d60b28c58026b84812815a0a7d4377e1a517a7fec66b017243eefa50b2251c4b36358aab046bf636e09f88f2ca85bdf37b13943c42c90370cc4394e9fd382907213689ce6beff62832ef6a71dee57909cb178bae38d32cd37ebcc575738efef601aaad11f6db29ddfce4d196a3ac34c414c65db56bff3d51d086a76c814833be41554b21b6832134a5f3747f8bf203136b1d931399�x�������������PO�������Xi
tt�?i.fi�d��Z�Rele�$J����������������
Z�[�Y�
�eg@redhat.com> 2.2-1Trond Eivind Glomsrød <teg@redhat.com> 2.2-0.11c1Trond Eivind Glomsrød <teg@redhat.com> 2.2-0.10b2Matt Wilson <msw@redhat.com> 2.2-0.9b2Matt Wilson <msw@redhat.com> 2.2-0.8b2Matt Wilson <msw@redhat.com> 2.2-0.7b1Trond Eivind Glomsrød <teg@redhat.com> 2.2-0.5b1Trond Eivind Glomsrød <teg@redhat.com> 2.2-0.4a4Trond Eivind Glomsrød <teg@redhat.com> 2.2-0.3a3Trond Eivind Glomsrød <teg@redhat.com> 2.2-0.2a3Trond Eivind Glomsrød <teg@redhat.com> 2.2-0.1a3Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Jeremy Hylton <jeremy@beopen.com>Jeremy Hylton <jeremy@beopen.com>Jeremy Hylton <jeremy@beopen.com>Jeremy Hylton <jeremy@beopen.com>Jeremy Hylton <jeremy@beopen.com>- Patch out PTY test for now
- Add Rocky to dists- Security fix for CVE-2022-48560
Resolves:             RHEL-16702- Fix for CVE-2022-48565
Resolves:             RHEL-7088- Security fix for CVE-2023-40217
Resolves:             RHEL-9621- Security fix for CVE-2023-24329
Resolves:             rhbz#2173917- Add missing part of fix for CVE-2022-45061 (#2145071)- Security fix for CVE-2022-45061: CPU denial of service via inefficient IDNA decoder
Resolves:             rhbz#2144072- Security fix for CVE-2015-20107
- Fix the test suite support for Expat >= 2.4.5
Resolves:             rhbz#2075390- Security fix for CVE-2022-0391: urlparse does not sanitize URLs containing ASCII newline and tabs
Resolves:             rhbz#2047376- Security fix for CVE-2021-4189: ftplib should not use the host from the PASV response
Resolves:             rhbz#2036020- Security fixes for CVE-2021-3737 and CVE-2021-3733
Resolves:             rhbz#1995162 and rhbz#1995234- Adjusted the postun scriptlets to enable upgrading to RHEL 9
- Resolves: rhbz#1933055- Security fix for CVE-2020-27619: eval() call on content received via HTTP in the CJK codec tests
Resolves:             rhbz#1889886- Fix for CVE-2021-23336
Resolves:             rhbz#1928904- Security fix for CVE-2021-3177
Resolves:             rhbz#1919163- Fixes for bundling prefix=/app build in gimp/inkscape containers
Resolves:             rhbz#1907592- Security fix for CVE-2020-26116: Reject control chars in HTTP method in httplib.putrequest
Resolves:             rhbz#1883258- Update to 2.7.18
Resolves:             rhbz#1886754- Avoid infinite loop when reading specially crafted TAR files (CVE-2019-20907)
Resolves:             rhbz#1856481- Update to 2.7.17
Resolves:             rhbz#1759944- Adding FIPS compliance to Python 2 in RHEL8:
  - Updated patch 146 with a new version of the FIPS patch
  - Patch 169 has been removed, obsoleted by the updated patch 146
Resolves:             rhbz#1734126- Use RPM built wheels of pip and setuptools in ensurepip instead of our rewheel patch
- Require python2-setuptools from python2-devel to prevent packaging errors
Resolves:             rhbz#1718398- Fix urlparse.urlsplit() error message for Unicode URL
Resolves:             rhbz#1689327- Security fix for CVE-2019-10160
Resolves:             rhbz#1689327- Security fix for CVE-2019-9948
Resolves:             rhbz#1704176- Disallow control chars in http URLs
- Fixes CVE-2019-9740 and CVE-2019-9947
Resolves:             rhbz#1703539 and rhbz#1704367- Remove pyc/pyo files from /usr/bin
Resolves:             rhbz#1696741- Updated fix for CVE-2019-9636
Resolves:             rhbz#1689327- Bumping due to problems with modular RPM upgrade path
- Resolves: rhbz#1695587- Fix coverity scan static analysis issues
Resolves:             rhbz#1690919- Security fix for CVE-2019-9636 (rhbz#1689327)- Update to 2.7.16
Resolves:             rhbz#1680967- Fix Tkinter
- Remove wininst exe files, that are no longer included, from the files section
- Resolves: rhbz#1656488- Fix launcher of pynche
- Resolves: rhbz#1656479- Remove remain�x��������������>�������Xj
 o�	?nnin� �������O������ 5er d�$0����������������
 55!5
�dafd1a473a0dd813bd3565b810dcb8ff8bc7907478a994c564d55200925894e0d32a63e555428ea64c707be08b33915b00053d2ee13a4eb5099e7d7713fc95a43813b511e1ccab5fb100edfbdc9236ffaa5812d774f72124c6d9ab624758fbd4bec058cdc282a9e1228b9db10eba8116bba19e6b66922b875c5c8587e720950f26989f3b017ba57aa6c938485dcddba1673deace0c0decea46b455a7b1700d8505b8c4acd012325920b3b32938cf557bf55d2c3272145c1e0232ee855bad673df75d389a0036b0d4e78aeb65d9fc45bfe7a2e5b9ece2245a3f15575c787f1eb57fe9ea7e03bdd74df6f411152794f8a6c57042d8ddda2272117436f97f1cd58c70509ac9b63232ba3cb844506236f2dad4de4946ad9d60df5aba1437d37b7adcb9cc179902eb6517f833258dca0d26de1f359bd22784b47b189d34da6208661fbca0f1f402a7b64b118c54f5bde063ec8dfada97f93a021a4f4ce0970ab8dd19df52e5fb2ccb53f8dc8f2008fe1e7bce4a99eda416139b79c40e32fe3420a14521ce3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b85595589973624c09c9578bfe6076ebe6773ad1c6d3b95e8f4e3676c70550acca45cfe214f590188e9b15b2a995b7b92e582eb78d1d7584332be8256bbee6a8f16d7a00d75041d79801bde74e31cf42ba00b0e0624bd4ac2daad7961455e36555088e4eaae7ac58d288e261fbe974ff8e6529bd793a9c01d46a842a0f22d7a63d80f25593ef927468138798f81f9aa4c749f3e93cca74d53f3834abb409179dc5c19baa069a40619060279f69d5e83e2113bf12099e961272bdaca759077b970487f1e5aa671778502e33945196ea2c98e9ffb6bae4fca4e09200b737219b7bfede6a7afe697adefc899fae4437e5cfeb7ed297c42f34bc909110a7b4e93ab5e470fcfa6f719174edcc04ef1afdb8a919aa1e5fe1411a23c96d094db13c9cda4e99034ad8e605c87b86c93a248644efe3fed1619e04413bc4193f33ed3f0e5d173a087dbba40b032a6bb864690052bc2dcbbbb429ab862c26512cf33368edcce6fa04a4bcc284139ca8aa79f7c7b310a152a2f8ab6651ff06f97dcf4c277cd00bcb032b12272bcf7e290230cb1356f6b1c2480389e10b0f975f47c149200baaee16cfea39d6fb7daff9762031b9222a1338a1b36677b8172dff15cfbbcedace8782db6c216f40bbd735c8b1a8b999a9a0eaacc11228a070122f683cb802cc376addc39645a4a93a6c0c67af00f6fc1ac5e44542eefcf3d0bdcb322f52c6b6dcffccf60a838ecf88c6c3e10586b9729befd85675299946f371a2baccb69459af22413813ed7354d4e661b2cb5f100ccc4a132604cf4c3115450d8f9bf4f978266216a2e88eb2e4b3bc8d0a8337563fc3e5c4869236cf5f6a585b8a29c011cfd42096107c8547c0fc958367c8353d971fc82a2815251c9e7141ae6b498e8bb1c1ba47c68d4be66f55b647e91492b4a459a42d56a386a618562b15667de4f646293e42fdbd0b01558b715bbd59a53ffb0dc3f1fd08452a426e37faebb57edcd45d853ce03d8f1026799f764ddeabb78cc97dc98ec1f358e7400a414125657da22e61b028940dd5e401afc8882b948aac9e3b957bf11b4049ecb9b7f16e334f4bfff25942c3c50f725ef20375eeb7ecd787bbcd31915a59cbedb35fd99a9c1d3455607be40f71474e29b911c2b328c135ec199554a26abb61ecad5b66ac8439ea1bd5f089cab63f5dd2e89323a1780a86177a8a185bcbb42c9d994d7e7887e9f2f27fa5725e31f512ddc3564cb4411bbcac00b17f8877701d2233b95371daa0a33a546b12a817c32013027f824c00889ea1fdb58b18022b4607655c439d1166dfc2a63bff4dbc0787ef69d4486973303188e1b903cfdc0c5322dd48444ed7e910d1e0c90c6cf00d0bfc2628d8d7b23fee89dda37b2d8c58cd9e3bd501b03ecf49355ce1da027072c4c8680b4233418c8b6ad4fbf63a9082de790baa464ad0db68d200d7745474de80029e3e25b0a775467c03ec13cc89523f14cca074e2f54ce044c3f57424d67a2f1da64accb100dc8d093be004e5f47b08047d326edf3338f36a3187e25df9e98e2c54472f0a56b6761fdc2f9eef87818c8597dade4b961c51d8cfa0469bf52dd7b2f1ff2e7919d0ce70f80112819fd7713363f2c153645c8f0811e1a7f390968a87dac69a75c6d4426584b162bce7b748ebf7dfe44dda4a20aa18506fd2a4e4c17b2b18612e07039a2516ba437e2dab561713dd36e8348e83e11d295dc6e25c1faa723bf76dca21a7a37df1332938fe3f8f79be88e03ca6d2b61966cf9c9e1b5ca038fc78b94c8b76a8fea7c0e4e5405be47fdbd0d2235bdca8f2804cc8808056dd50e3e621f0c87e21dcdca161489f24323a1fd904b923ed8dc90f00904e718f0eab4918739ef42aeb8f4e4beeaa302586e7da13673db0251b9bae36d0e53c1b688e99f52140bce623233cdb149ae7e3a529709cd03e5dbe26e4d0319f9f61c34bdeeee936bb7eea0d8440eec06d15e48dcf923c46305cc41b2e676a421ead8c3c5b4b33e0e5bd1c7a3381ac169dbb7618638f9b7b2f896d23a3067498de6addc14be4d89f546b505570b9f50c6ac6edccb7d8468cbf1d710d7854fdf2d136b16bc5870755fca8f2f93d8fcb3a24cf0dff1b12c5516be91272728f6356c04cbdaa6c534de8cfc341ae32cabc2a8e92222fe8fd4fa901991d034b5ed9b6abe84763c08cf60e57f2f78a9dc67de803d9959e79f2e3499fa13e5ffaa26c2391ab55ab1e38694ce35afb�x�������������@.�������Xk
sh�?loca��������(��������usr/�$����������������
���
�r messages if we just
  return PAM_IGNORE for all cases)- reorder patches so that the reentrancy patch is applied last -- we never
  came to a consensus on how to guard against the bugs in calling applications
  which this sort of change addresses, and having them last allows for dropping
  in a better strategy for addressing this later on- pam_rhosts: allow "+hostname" as a synonym for "hostname" to jive better
  with the hosts.equiv(5) man page
- use the automake install-sh instead of the autoconf install-sh, which
  disappeared somewhere between 2.50 and now- add pwdb as a buildprereq- pam_tally: don't try to read past the end of faillog -- it probably contains
  garbage, which if written into the file later on will confuse /usr/bin/faillog- pam_limits: don't just return if the user is root -- we'll want to set the
  priority (it could be negative to elevate root's sessions)
- pam_issue: fix off-by-one error allocating space for the prompt string- pam_mkhomedir: recurse into subdirectories properly
- pam_mkhomedir: handle symlinks
- pam_mkhomedir: skip over special items in the skeleton directory- add cracklib as a buildprereq
- pam_wheel: don't ignore out if the user is attempting to switch to a
  unprivileged user (this lets pam_wheel do its thing when users attempt
  to get to system accounts or accounts of other unprivileged users)- pam_xauth: close a possible DoS due to use of dotlock-style locking in
  world-writable directories by relocating the temporary file to the target
  user's home directory
- general: include headers local to this tree using relative paths so that
  system headers for PAM won't be pulled in, in case include paths don't
  take care of it- pam_xauth: rewrite to skip refcounting and just use a temporary file
  created using mkstemp() in /tmp- pam_userdb: fix the key_only flag so that the null-terminator of the
  user-password string isn't expected to be part of the key in the db file,
  matching the behavior of db_load 3.2.9- pam_unix: use crypt() instead of bigcrypt() when salted field is less than
  the critical size which lets us know it was generated with bigcrypt()
- use a wrapper to handle ERANGE errors when calling get....._r functions:
  defining PAM_GETPWNAM_R and such (for getpwnam, getpwuid, getgrnam,
  getgrgid, and getspnam) before including _pam_macros.h will cause them
  to be implemented as static functions, similar to how defining PAM_SM_xxx
  is used to control whether or not PAM declares prototypes for certain
  functions- pam_unix: argh, compare entire pruned salt string with crypted result, always- ship /lib/lib{pam,pam_misc}.so for legacy package builds- noreplace configuration files in /etc/security
- pam_console: update pam_console_apply and man pages to reflect
  /var/lock -> /var/run move- pam_unix: fix the fix for #42394- modules: use getpwnam_r and friends instead of non-reentrant versions
- pam_console: clear generated .c and .h files in "clean" makefile target- pam_stack: perform deep copy of conversation structures
- include the static libpam in the -devel subpackage (#52321)
- move development .so and .a files to %{_libdir}
- pam_unix: don't barf on empty passwords (#51846)
- pam_unix: redo compatibility with "hash,age" data wrt bigcrypt (#42394)
- console.perms: add usb camera, scanner, and rio devices (#15528)
- pam_cracklib: initialize all options properly (#49613)- pam_limits: don't rule out negative priorities- pam_xauth: fix errors due to uninitialized data structure (fix from Tse Huong
  Choo)
- pam_xauth: random cleanups
- pam_console: use /var/run/console instead of /var/lock/console at install-time
- pam_unix: fix preserving of permissions on files which are manipulated- fix segfault in pam_securetty- pam_console: use /var/run/console instead of /var/lock/console for lock files
- pam_issue: read the right number of bytes from the file- pam_wheel: don't error out if the group has no members, but is the user's
  primary GID (reported by David Vos)
- pam_unix: preserve permissions on files which are manip�x���������������������Xl
av�?antr�����������4t.co�$m����������������
�4�4�4
�'()**+,--.///0123456789:;;<<=>??@@ABCDDDEFGHIJKLMNOOPQRSQTTTTTTTTTTTUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUTTTTTTTTTTTTTTTTTTTTTTTTTVVWXXXYYYYYYYYYYYYYYYYYYYYYYYZ[\[]]]]]]]]]]]]]]]]]]]]]]]]]][^[_[[`[a[[b[[c[d[e[f[[[g[h[i[[[[[[[[[jk[l[m[n[o[p[q[r[s[t[uuuvmysqlmy.cnfmy.cnf.dpercona-server.cnfpercona-server.conf.dmysqld.cnfmysqld_safe.cnfinnochecksumlz4_decompressmy_print_defaultsmyisam_ftdumpmyisamchkmyisamlogmyisampackmysql_install_dbmysql_pluginmysql_secure_installationmysql_ssl_rsa_setupmysql_tzinfo_to_sqlmysql_upgrademysqld_pre_systemdmysqldumpslowperrorps-adminps_mysqld_helperreplaceresolve_stack_dumpresolveipzlib_decompress.build-id007df4d97fe6d684a784abbcb713cc26849c48eb054e13152667867d04e29c978ee54f223e2e5be70664066ba59b9106b230d4981002234259f020b2bf2476bc17fc42ee1fe1b93b79d70ece2c40af0be94d5de9a7ce1190834018de8c8867e977fa790c1ced86467ac9dde70e9b9ed51a54c311267b6f0d0f35eb8f6876eb5e3e7ef4c3f4cf884fec84510fdc0eb9b050d8d687867cd2e0906599934e4b0710646202b65eb888ce9077f9b5582e93154489b312c2a970c257495aa4b54a8b8ac019e1f814f0531782d4bad764376a8ba20db2acaf0dedf6b68c3719bb1914e8dacbcdf496a1e1539eb27122b8be441bbe288ced3aedd8861a8311caa6e4929e1894d81c702ff848ee3832f0703df4b4ab05b2d0a28c5f200ffe99430078b8febe0203770c8c5e62b7eac482d705d713dce47206ed2116c1da3e639817ac21fca4502ddcdba3c8703c5ddaaeaef86cf225be248e6a897c09236bcca6a662b362b3066c0a738e2983a1bd8331d49dfb5b4f0422cc7547b8e9a8e72c3f2bd077183616a2c34f7e35890d3c69adb66af0e1e23a7632d9b14f11ef5aec82b6ee4d8f53343d32abada3dcae7971998de6e81a1ee496ab703887b0695a4592da3097fd8a9aa257d07e042103391c803890f5b8ae2218aea893b05d98f063658f3b6fc1df931565507858f169aedaef9fe741452c3c99259c2fa76a7df60ec48068c6dfa3ec621d853d2850dc5fdd42b5e1a5893a039f0da9a4054df94292c5468b09f691fbf6946b129634f209937cf74dff13e2ab3ab335fd58b8c871f245a6c3dd33d6505f3b2b2635659d09e11d58b5d03e036745b1f251962b73786c1c1f0ad0a10b3522ea1c555d2617b46b7cb6613724b69a3e2e8bc8c4932e344b8e55f3b5efa4fa277d3e139b7a144f4e51df35000359c2d11f0c749f25178e9375471f282aa768e4fe5a856beb73cc79e374759edfa3d4c35122628dad61a92f31841f52672034cf461427b1ddf700c5ea6417f5ad5b23288b75c48e64a26765545955117466eff003a3058676ec1d39e32b6a0b9456bf52e4f0b7c40ec5de5f1787637ad5ea18065c6f0aa267f1750b2ca04763a8866a74f257733f2b1695e77cd85a2d480cdf294f3e364d14b15e6410fe350380967b41fb431f030c384e9ca1d7aa0b58c99b9de95feda5ef20690031ab02757d1b23bed3d89c8328ec0075646d7449c0c0a50abb4e732ab6ff968633a83dffdddbbc470816b7283dae30d10f902b999206498f5c349b825b5195683b36addbb37e62b7b97295af7328e85fc7e78d82eb879004bbe89ebda43e62112defaaeadf58f9acc3bd2a83ce24a2429406d8d4216e1684447f42082a413add0177b806ad7f7b6428afe8d8ebc8857fc9b535de96cc8b92db81ca7da23cfdf621516ad2ba188848a8bc88fdbeb6b6c4e01aaf74350720d54b5a2cdbab713aa1309511e3903e99a0c7747d8d5eb6be76b1e7cfb0cec97f3bce10595ff43b16bdab9f8039b7ee6d5ee81f26c327a29df857e501b5c68933e4ba232eb239508543b126247b27a4c6559e02ea99bb5a384dbb93917f8fe9ce1441ebbdcd08f87eafc6d7d07a38d18029a11b655e86798368157d23c2c9b4b863f35c1a51c58130c6d66f82713715630fcb12116039fb85aeda079a9c2c7bb614945d5267d07f�x�������������0
�������Xm
cea?6f28�����������a28�$+����������������
������
�-zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files noreplace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc chan�x�������������������Xn
n �?abha����������_ 0.7�$����������������
�_�_�_
�@redhat.com> - 12:4.1.1-14Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-13Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-12Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-11Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-10Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-9Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-8Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-7Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-6Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-5Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-4Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-3Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-2Jiri Popelka <jpopelka@redhat.com> - 12:4.1.1-1Jiri Popelka <jpopelka@redhat.com> - 12:4.1.0p1-18Jiri Popelka <jpopelka@redhat.com> - 12:4.1.0p1-17Jiri Popelka <jpopelka@redhat.com> - 12:4.1.0p1-16Jiri Popelka <jpopelka@redhat.com> - 12:4.1.0p1-15Jiri Popelka <jpopelka@redhat.com> - 12:4.1.0p1-14Jiri Popelka <jpopelka@redhat.com> - 12:4.1.0p1-13Jiri Popelka <jpopelka@redhat.com> - 12:4.1.0p1-12Jiri Popelka <jpopelka@redhat.com> - 12:4.1.0p1-11David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-10David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-9David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-8David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-7David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-6David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-5David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-4David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-3David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-2David Cantrell <dcantrell@redhat.com> - 12:4.1.0p1-1David Cantrell <dcantrell@redhat.com> - 12:4.1.0-27Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 12:4.1.0-26David Cantrell <dcantrell@redhat.com> - 12:4.1.0-25David Cantrell <dcantrell@redhat.com> - 12:4.1.0-24David Cantrell <dcantrell@redhat.com> - 12:4.1.0-23David Cantrell <dcantrell@redhat.com> - 12:4.1.0-22David Cantrell <dcantrell@redhat.com> - 12:4.1.0-21David Cantrell <dcantrell@redhat.com> - 12:4.1.0-20David Cantrell <dcantrell@redhat.com> - 12:4.1.0-19David Cantrell <dcantrell@redhat.com> - 12:4.1.0-18David Cantrell <dcantrell@redhat.com> - 12:4.1.0-17David Cantrell <dcantrell@redhat.com> - 12:4.1.0-16David Cantrell <dcantrell@redhat.com> - 12:4.1.0-15David Cantrell <dcantrell@redhat.com> - 12:4.1.0-14David Cantrell <dcantrell@redhat.com> - 12:4.1.0-13David Cantrell <dcantrell@redhat.com> - 12:4.1.0-12David Cantrell <dcantrell@redhat.com> - 12:4.1.0-11David Cantrell <dcantrell@redhat.com> - 12:4.1.0-10Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 12:4.1.0-9David Cantrell <dcantrell@redhat.com> - 12:4.1.0-8David Cantrell <dcantrell@redhat.com> - 12:4.1.0-7David Cantrell <dcantrell@redhat.com> - 12:4.1.0-6Tomas Mraz <tmraz@redhat.com> - 12:4.1.0-5David Cantrell <dcantrell@redhat.com> - 12:4.1.0-4David Cantrell <dcantrell@redhat.com> - 12:4.1.0-3David Cantrell <dcantrell@redhat.com> - 12:4.1.0-2David Cantrell <dcantrell@redhat.com> - 12:4.1.0-1David Cantrell <dcantrell@redhat.com> - 12:4.0.0-34David Cantrell <dcantrell@redhat.com> - 12:4.0.0-33David Cantrell <dcantrell@redhat.com> - 12:4.0.0-32David Cantrell <dcantrell@redhat.com> - 12:4.0.0-31David Cantrell <dcantrell@redhat.com> - 12:4.0.0-30David Cantrell <dcantrell@redhat.com> - 12:4.0.0-29David Cantrell <dcantrell@redhat.com> - 12:4.0.0-28David Cantrell <dcantrell@redhat.com> - 12:4.0.0-27David Cantrell <dcantrell@redhat.com> - 12:4.0.0-26David Cantrell <dcantrell@redhat.com> - 12:4.0.0-25David Cantrell <dcantrell@redhat.com> - 12:4.0.0-24David Cantrell <dcantrell@redhat.com> - 12:4.0.0-23David Cantrell <dcantrell@redhat.com> - 12:4.0.0-22David Cantrell <dcantrell@redhat.com> - 12:4.0.0-21David Cantrell <dcantrell@redhat.com> - 12:4.0.0-20David Cantrell <dcantrell@redhat.com> - 12:4.0.0-19Tom "spot" Callaway <tcallawa@redhat.com> - 12:4.0.0-18David Cantrell <dcantrell@redhat.com> - 12:4.0.0-17David Cantrell <dcantrell@redhat.com> - 12:4.0.0-16David Cantrell <dcantrell@redhat.com> - 12:4.0.0-15�x������������� �����Xo
_�|?�^���������@[
IN
�\��$Y����������������
INJNHN
�l helpers for matching messages.
- Change Plugin to work better with more than one solution.- Fix setroubleshoot_dispatcher to catch all information from
   avc. Much cleaner interface and no longer uses audit2allow cruft.
- Remove toolbar from popup window since it did nothing, and I
   think it looks better without it.
- fix allow_execmod plugin to report better data.- add missing /var/log directory files section in spec file,
   and add logrotate script- clean up spec file, reduce rpmlint complaints- Initial build./bin/sh/bin/sh/bin/sh/bin/sh

















































































































































	
  ""$$&&((**,,..0022446789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~�������������������asbgbnbncacsdadeeleneseufifrfurglguhehihrhuitjaknkomaimlmrmsnbndsnlnnorpaplptptrusisksrsr@latinsvtatethtrukzhzh��3.3.26-6.el81.11.13.3.26-6.el83.3.26-6.el8


		



















 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFFFGHIIJKKsedispatch.conforg.fedoraproject.SetroubleshootFixit.conforg.fedoraproject.SetroubleshootPrivileged.conforg.fedoraproject.Setroubleshootd.confsetroubleshootsetroubleshoot.confsetroubleshootsealert.build-id0cfb0d77dd3a8198a22380bf13b29c485b28b3e4setroubleshootsetroubleshoot-1.1-py3.6.egg-infoPlugin.py__init__.py__pycache__Plugin.cpython-36.opt-1.pycPlugin.cpython-36.pyc__init__.cpython-36.opt-1.pyc__init__.cpython-36.pycaccess_control.cpython-36.opt-1.pycaccess_control.cpython-36.pycanalyze.cpython-36.opt-1.pycanalyze.cpython-36.pycaudit_data.cpython-36.opt-1.pycaudit_data.cpython-36.pycavc_audit.cpython-36.opt-1.pycavc_audit.cpython-36.pycconfig.cpython-36.opt-1.pycconfig.cpython-36.pycemail_alert.cpython-36.opt-1.pycemail_alert.cpython-36.pycerrcode.cpython-36.opt-1.pycerrcode.cpython-36.pychtml_util.cpython-36.opt-1.pychtml_util.cpython-36.pycrpc.cpython-36.opt-1.pycrpc.cpython-36.pycrpc_interfaces.cpython-36.opt-1.pycrpc_interfaces.cpython-36.pycserver.cpython-36.opt-1.pycserver.cpython-36.pycserverconnection.cpython-36.opt-1.pycserverconnection.cpython-36.pycsignature.cpython-36.opt-1.pycsignature.cpython-36.pycutil.cpython-36.opt-1.pycutil.cpython-36.pycuuid.cpython-36.opt-1.pycuuid.cpython-36.pycxml_serialize.cpython-36.opt-1.pycxml_serialize.cpython-36.pycaccess_control.pyanalyze.pyaudit_data.pyavc_audit.pyconfig.pyemail_alert.pyerrcode.pyhtml_util.pyrpc.�x�������������������Xp
�?RC������hR'�$M����������������
�h�h�h
�34112c7f5260171f49d613f96f4977cb94575e1ebdb2de9baa873cab741448a0bee25c7f5260171f49d613f96f4977cb94575e1ebdb2de9baa873cab741448a0bee258ebbb6e7499dbf2d68fc93a0159c6e994cb0aaa66220aa1850e5527f5c2dca028ebbb6e7499dbf2d68fc93a0159c6e994cb0aaa66220aa1850e5527f5c2dca02bb1823e6469944ca8c383551bfbd9ef0fb84fafdce3380e87b84ac7374d363f6bb1823e6469944ca8c383551bfbd9ef0fb84fafdce3380e87b84ac7374d363f6c130fb47f11c073ee4fe9de8f1867794d27e791b8d3abb0c98b98aa737c87e3ac130fb47f11c073ee4fe9de8f1867794d27e791b8d3abb0c98b98aa737c87e3a777bb9a964ebc56d18a31ed87520f43c0059fbfce5c95477cbb1e6f751339608777bb9a964ebc56d18a31ed87520f43c0059fbfce5c95477cbb1e6f75133960834e024b2fb556da51751cd4f23bafede4f8e6eb27e056865e52ab184bbd76576f0c91e590c7894ce01733b256256124f37ecb78e53e989e0832f894ac37015e873b85af192f61dcf4ec9e78c46fbe131bea6b4fe8c501430f4ea4a4ee3e9d24273b85af192f61dcf4ec9e78c46fbe131bea6b4fe8c501430f4ea4a4ee3e9d242e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855c8e2c1d30fcec332241e137c058b7a2ef060645d6bf27acd9df03d49b39866ccc8e2c1d30fcec332241e137c058b7a2ef060645d6bf27acd9df03d49b39866ccf15fe4bca2f1c1b9b94255f77fe0880aaf6c23ad108f90876c7a67e9f4e70978f15fe4bca2f1c1b9b94255f77fe0880aaf6c23ad108f90876c7a67e9f4e70978894cb54553f5f8612a791bf82dd40061f1c75c3155df31e157eb023f9845c761894cb54553f5f8612a791bf82dd40061f1c75c3155df31e157eb023f9845c761ce47023d337fe9370b5b436b960d35efaf91d5043f5953d39bcb33d51e3e1e33fef35a7394ebcf0b2bcdb38521b17ee5c1ea73f63668f4f60fbceb211d3a04ea4a801e0731905e3a33d898842c964fc66ee1d2909df14ad2c00592d034003aa54a801e0731905e3a33d898842c964fc66ee1d2909df14ad2c00592d034003aa52157719631f2c64e515bc2bf8df4b46826ec98487151ef1dc610362de31052b12157719631f2c64e515bc2bf8df4b46826ec98487151ef1dc610362de31052b1ee695e43c4303460352e4a3f1ff4a5796bd4a446fa2e8b74214e9c46ea2b3cbeee695e43c4303460352e4a3f1ff4a5796bd4a446fa2e8b74214e9c46ea2b3cbe52fe1cc85126d959f730df36c012d2d47f4a89d0b67554c73bf5ac75b7b0fc2c52fe1cc85126d959f730df36c012d2d47f4a89d0b67554c73bf5ac75b7b0fc2c0f76b8dba3d2fad7507ab6d09cb5bf98dd9a038986e496a51a1773a3ba83a644c6e02608bd36fdabb83878cb02eca95f29fe7c716a781dd9f76c4a565a5e479248f5b39d99d203f89cee1110e266d954449b20c2b08f608a5ebb6bc8e03f241948f5b39d99d203f89cee1110e266d954449b20c2b08f608a5ebb6bc8e03f24192243c6202a0f00dc3ef8b5a0fbee9d2a3003f165e33ce65ab07e9403fca231a32243c6202a0f00dc3ef8b5a0fbee9d2a3003f165e33ce65ab07e9403fca231a3fbd667d19ccb417d15b373e44744d99d090feceb5491431fb89be8e608443337fbd667d19ccb417d15b373e44744d99d090feceb5491431fb89be8e608443337fc133f5d7be8b791a3fada6083bf0bc8e36390b361312e2b3a19a5e68ed8ddfcfc133f5d7be8b791a3fada6083bf0bc8e36390b361312e2b3a19a5e68ed8ddfc562fc0d2b0107876d4f9af57d2db75c909bd46a92041b0d2c73470f16954f640448984089e1cff04e5693618c1960b1c489e6c331a00998ad683c0461c354f9a1afa64f44636d3229a31388a81067cc85104a6876a560558b5f7a4a2273562dbb78e0cd87556b6bf29848cf63a19c82f3b864f7ad30136a8bdcb55d5da6754884803117abcceddf2b622415909a664bb065a2ff106a8734ecf8a678b8be19cddde6e96bcf9ba34dc44f2b9131a69f4afbe41fc66521a0ee291a7f11ec04dd5603b01a7c587ebda084dcd8c79f6a588064acadd29c1ea7f997ddd5768ba679ccd3e27de2d8dfe5a121c055ccbb6fd14e13fe9c03b4faee061042920e6f2ea6b6f03a85d259563237b7f81e79b67d07352fc11ac85e8d257f0cd094cd8b70ac9ab930f086ff94a8c27273ca35b4bb87c1f3b5154ad1de5169c537aff2917559e6316595a293af5bd22728947918d5244666784691ce162e78d9629ad7306896daf356cc9d00d4111e9e066955ea94c962cd9b66e4e0fdc5e222f941412b1f2ee40466fc76d720e42708eb165e8355833c4c2ee6ea1e5b8219f53e2b4aaba98a874466fc76d720e42708eb165e8355833c4c2ee6ea1e5b8219f53e2b4aaba98a8743ca22c5c6ea6d12f14691c1935180e3ee52ec57ff279ce3feaadbf150e4708913ca22c5c6ea6d12f14691c1935180e3ee52ec57ff279ce3feaadbf150e47089140e5f70e6d6c6519ea913864ddef7fb7647b6cdbbe6ec23ae88ee986d41540c740e5f70e6d6c6519ea913864ddef7fb7647b6cdbbe6ec23ae88ee986d41540c730a3311370f5cf883ec190058edc0105b1b139179acdd3fe3ab4c60ee226dfdb30a3311370f5cf883ec190058edc0105b1b139179acdd3fe3ab4c60ee226dfdb70b246e4e91caef1ea55fa25b3602d5ef80b6b7ec39f9db88501226d5ef59d3e70b246e4e91caef1ea55fa25b360�x������������������Xq
!�?P�7�@s������(�������
Sql�$����������������
�
�
�

�i@fedoraproject.org> - 1.14.0-0.2.20170301devRemi Collet <remi@fedoraproject.org> - 1.14.0-0.1.20170219devRemi Collet <remi@fedoraproject.org> - 1.13.5-2Remi Collet <remi@fedoraproject.org> - 1.13.5-1Remi Collet <remi@fedoraproject.org> - 1.13.4-2Remi Collet <remi@fedoraproject.org> - 1.13.4-1Remi Collet <remi@fedoraproject.org> - 1.13.3-1Remi Collet <remi@fedoraproject.org> - 1.13.2-1Remi Collet <remi@fedoraproject.org> - 1.13.1-3Remi Collet <remi@fedoraproject.org> - 1.13.1-2Remi Collet <remi@fedoraproject.org> - 1.13.1-1Remi Collet <remi@fedoraproject.org> - 1.13.0-1Remi Collet <remi@fedoraproject.org> - 1.12.5-1Remi Collet <remi@fedoraproject.org> - 1.12.1-3Remi Collet <rcollet@redhat.com> 1.12.1-2Remi Collet <remi@fedoraproject.org> - 1.12.4-2Remi Collet <remi@fedoraproject.org> - 1.12.4-1Remi Collet <remi@fedoraproject.org> - 1.12.3-1Remi Collet <remi@fedoraproject.org> 1.12.2-2Remi Collet <remi@fedoraproject.org> 1.12.2-1Remi Collet <remi@fedoraproject.org> 1.12.1-2.1Remi Collet <rcollet@redhat.com> 1.12.1-2Remi Collet <rcollet@redhat.com> 1.12.1-1- update to 1.22.3
- build out of sources tree- rebuild for PHP 8.3.0RC1- update to 1.22.2- update to 1.22.1- update to 1.22.0- add upstream patches for 8.3- update to 1.21.1- rebuild for PHP 8.2.0RC1- add upstream patch for 8.2.0beta1- require minimal libzip version
- rebuild using libzip5 on EL-7- rebuild using libzip 1.9.2 (remi-libzip on EL)- update to 1.21.0- more upstream patch for PHP 8.2- add upstream patch for PHP 8.2- update to 1.20.1- use remi-libzip on EL-9- update to 1.20.0- test build for 1.20.0-dev- test build for 1.20.0-dev- update to 1.19.5- update to 1.19.4- rebuild for 8.1.0RC1- rename configuration file to 30-zip.ini to ensure zip extension
  will be loaded before imagick to find proper libzip
  reported as https://github.com/remicollet/remirepo/issues/182- rebuild with libzip 1.8.0 and zstd support- update to 1.19.3- F34 rebuild for https://github.com/remicollet/remirepo/issues/174- update to 1.19.2- rebuild against latest libzip SCL packages (EL-8)- update to 1.19.1- rebuild for 8.0.0beta4- rebuild for 8.0.0beta3- rebuild for 8.0.0beta2- rebuild for 8.0.0beta1- more change for PHP 8.0
- procedural API is deprecated- fix encode parameter is option- update to 1.19.0- refresh for test suite- update to 1.19.0-dev- update to 1.18.2- update to 1.18.1- update to 1.18.0- update to 1.18.0RC6- update to 1.18.0RC5- update to 1.18.0RC4- update to 1.18.0RC3- update to 1.18.0RC2- update to 1.18.0RC1- update to 1.17.2- update to 1.17.1- update to 1.17.0- update to 1.16.1- update to 1.16.0- update to 1.15.5- rebuild for 7.4.0RC1- rebuild for 7.4.0beta1- rebuild- add upstream patch for 7.4- EL-8 build- update to 1.15.4 (stable)- rebuild for 7.3.0beta2 new ABI- rebuld for 7.3.0alpha4 new ABI- rebuild for PHP 7.3.0alpha2 new API- update to 1.15.3 (stable)- update to 1.15.2 (stable)- add upstream patch for libzip 1.3.1- F27: release bump- rebuild for PHP 7.2.0beta1 new API- update to 1.15.1 (stable)- update to 1.15.0 (stable)- rebuild for 7.2.0alpha2- update to 1.14.0 (stable)
- always buid with system libzip (bundled lib dropped upstream)- refresh with pasword support in stream wrapper- update to 1.4.0-dev with encryption support
- raise dependency on libzip 1.2.0- rebuild with PHP 7.1.0 GA- Update to 1.13.5- rebuild for PHP 7.1 new API version- Update to 1.13.4- Update to 1.13.3- Update to 1.13.2
- fix license management- rebuild for PHP 7.0.0RC5 new API version- F23 rebuild with rh_layout- Update to 1.13.1- Update to 1.13.0
- raise dependency on libzip 1.0.0- Update to 1.12.5
- Don't install/register tests- new scriptlets- allow SCL build- add numerical prefix to extension configuration file- Update to 1.12.4 (stable) for libzip 0.11.2- Update to 1.12.3 (stable)
- drop merged patch- upstream patch, don't use any libzip private struct
- drop LICENSE_libzip when system version is used
- always build ZTS extension- update to 1.12.2 �x�������������������Xr
��m?������������pX������cE�����$s����������������
cEdEbE
�dhat.com> - 3.0.13-1<dwalsh@redhat.com> - 3.0.12-2<dwalsh@redhat.com> - 3.0.12-1<dwalsh@redhat.com> - 3.0.11-1<dwalsh@redhat.com> - 3.0.9-1<dwalsh@redhat.com> - 3.0.8-1<dwalsh@redhat.com> - 3.0.7-1<dwalsh@redhat.com> - 3.0.6-1Dan Walsh <dwalsh@redhat.com> - 2.2.69-1Dan Walsh <dwalsh@redhat.com> - 2.2.67-1Dan Walsh <dwalsh@redhat.com> - 2.2.66-1Dan Walsh <dwalsh@redhat.com> - 2.2.65-1Dan Walsh <dwalsh@redhat.com> - 2.2.64-1Dan Walsh <dwalsh@redhat.com> - 2.2.63-2Dan Walsh <dwalsh@redhat.com> - 2.2.63-1Dan Walsh <dwalsh@redhat.com> - 2.2.62-1Dan Walsh <dwalsh@redhat.com> - 2.2.61-1Dan Walsh <dwalsh@redhat.com> - 2.2.60-1Dan Walsh <dwalsh@redhat.com> - 2.2.58-1Dan Walsh <dwalsh@redhat.com> - 2.2.57-1Dan Walsh <dwalsh@redhat.com> - 2.2.56-1Dan Walsh <dwalsh@redhat.com> - 2.2.55-2Dan Walsh <dwalsh@redhat.com> - 2.2.52-1Dan Walsh <dwalsh@redhat.com> - 2.2.50-1Dan Walsh <dwalsh@redhat.com> - 2.2.48-1Dan Walsh <dwalsh@redhat.com> - 2.2.47-1Dan Walsh <dwalsh@redhat.com> - 2.2.46-1Dan Walsh <dwalsh@redhat.com> - 2.2.45-1Dan Walsh <dwalsh@redhat.com> - 2.2.44-1Dan Walsh <dwalsh@redhat.com> - 2.2.43-1Dan Walsh <dwalsh@redhat.com> - 2.2.42-1Dan Walsh <dwalsh@redhat.com> - 2.2.41-1Dan Walsh <dwalsh@redhat.com> - 2.2.40-1Dan Walsh <dwalsh@redhat.com> - 2.2.39-1Dan Walsh <dwalsh@redhat.com> - 2.2.38-1Dan Walsh <dwalsh@redhat.com> - 2.2.37-1Dan Walsh <dwalsh@redhat.com> - 2.2.36-1Dan Walsh <dwalsh@redhat.com> - 2.2.35-1Dan Walsh <dwalsh@redhat.com> - 2.2.33-1Dan Walsh <dwalsh@redhat.com> - 2.2.32-1Dan Walsh <dwalsh@redhat.com> - 2.2.31-1Dan Walsh <dwalsh@redhat.com> - 2.2.30-1Dan Walsh <dwalsh@redhat.com> - 2.2.28-1Dan Walsh <dwalsh@redhat.com> - 2.2.27-1Dan Walsh <dwalsh@redhat.com> - 2.2.26-1Dan Walsh <dwalsh@redhat.com> - 2.2.25-1Dan Walsh <dwalsh@redhat.com> - 2.2.24-1Dan Walsh <dwalsh@redhat.com> - 2.2.23-3Dan Walsh <dwalsh@redhat.com> - 2.2.23-2Dan Walsh <dwalsh@redhat.com> - 2.2.23-1Dan Walsh <dwalsh@redhat.com> - 2.2.22-2Dan Walsh <dwalsh@redhat.com> - 2.2.22-1Dan Walsh <dwalsh@redhat.com> - 2.2.21-2Dan Walsh <dwalsh@redhat.com> - 2.2.21-1Dan Walsh <dwalsh@redhat.com> - 2.2.20-1Dan Walsh <dwalsh@redhat.com> - 2.2.19-1Dan Walsh <dwalsh@redhat.com> - 2.2.18-2Dan Walsh <dwalsh@redhat.com> - 2.2.18-1Dan Walsh <dwalsh@redhat.com> - 2.2.17-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.2.16-2Dan Walsh <dwalsh@redhat.com> - 2.2.16-1Dan Walsh <dwalsh@redhat.com> - 2.2.15-1Dan Walsh <dwalsh@redhat.com> - 2.2.14-1Dan Walsh <dwalsh@redhat.com> - 2.2.13-1Dan Walsh <dwalsh@redhat.com> - 2.2.12-1Dan Walsh <dwalsh@redhat.com> - 2.2.11-1Dan Walsh <dwalsh@redhat.com> - 2.2.10-1Dan Walsh <dwalsh@redhat.com> - 2.2.9-1Dan Walsh <dwalsh@redhat.com> - 2.2.8-1Dan Walsh <dwalsh@redhat.com> - 2.2.1-1Dan Walsh <dwalsh@redhat.com> - 2.2.1-1Dan Walsh <dwalsh@redhat.com> - 2.2.1-1Dan Walsh <dwalsh@redhat.com> - 2.1.13-2Thomas Liu <tliu@redhat.com> - 2.1.12-2Dan Walsh <dwalsh@redhat.com> - 2.1.12-1Dan Walsh <dwalsh@redhat.com> - 2.1.11-1Dan Walsh <dwalsh@redhat.com> - 2.1.10-1Dan Walsh <dwalsh@redhat.com> - 2.1.9-1Dan Walsh <dwalsh@redhat.com> - 2.1.8-1Dan Walsh <dwalsh@redhat.com> - 2.1.7-1Dan Walsh <dwalsh@redhat.com> - 2.1.6-2Dan Walsh <dwalsh@redhat.com> - 2.1.6-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.1.5-2Dan Walsh <dwalsh@redhat.com> - 2.1.5-1Dan Walsh <dwalsh@redhat.com> - 2.1.4-1Dan Walsh <dwalsh@redhat.com> - 2.1.3-1Dan Walsh <dwalsh@redhat.com> - 2.1.2-1Dan Walsh <dwalsh@redhat.com> - 2.1.1-1Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 2.0.12-2Dan Walsh <dwalsh@redhat.com> - 2.0.12-1Dan Walsh <dwalsh@redhat.com> - 2.0.11-1Dan Walsh <dwalsh@redhat.com> - 2.0.10-2Dan Walsh <dwalsh@redhat.com> - 2.0.10-1Dan Walsh <dwalsh@redhat.com> - 2.0.8-2Dan Walsh <dwalsh@redhat.com> - 2.0.8-1<jdennis@redhat.com> - 2.0.6-1John Dennis <jdennis@redhat.com> - 2.0.5-1<jdennis@redhat.com> - 2.0.4-1<jdennis@redhat.com> - 2.0.2-1<jdennis@redhat.com> - 2.0.1-1<jdennis@redhat.com> - 2.0.0-1John De�x������������������Xs
s��	?PUIn`�ȸ���6537d2�$&����������������
655575
�UUVVVWWWWWWWWWWWVUXUYZ[\\\\\\\]]]]]]^^^^^^^^^^^______^^`````aaaaaaaa``````bbbbbbbcccdddddddeeeeeeeeeeeeeeeeeeeeeeeeddddddddddddddddddddddddccffgggffhhhhhhhhhhhfccccccciiiiiiiiiiiiiiiiiiiiiiiiicccccccjccccccccccccccccccckkkkkkkllllmmmmlllllnnooolpqrsssssssrrtrruuuuuuuvvvvvvvvvvvvvvvvvvvvrrwwwwwwwwwxxxxxyyyzz{{{{{{{{{{{{{{{{{y|||}}}}}~~}}|y������������������������������������������������xxx��������rr�������������������r�����������������������lwdbadmin.iniaudit-servicelwdbprovdetcbash_completion.dlwmyctrllwpgctrlcron.dpostgresql-service-auditlocaweblwdbadminmysql.cnfpgsql.cnflwdbadmin-log.ymlprofile.dlwdbadmin-pgsql.shuwsgi.dlwdbadmin.iniliblwdbadminlwdbadmin-1.0.1-py3.6.egg-infoPKG-INFOSOURCES.txtdependency_links.txttop_level.txt__init__.py__pycache____init__.cpython-36.pycbase.cpython-36.pycbottle.cpython-36.pycutil.cpython-36.pycapi__init__.py__pycache____init__.cpython-36.pycauth.cpython-36.pycerror.cpython-36.pycmysql.cpython-36.pycpgsql.cpython-36.pycauth.pyerror.pymysql.pypgsql.pybase.pybottle.pymysql__init__.py__pycache____init__.cpython-36.pyclibmysql.cpython-36.pyclwmysrvadm.cpython-36.pyclibmysql.pylwmysrvadm.pypgsql__init__.py__pycache____init__.cpython-36.pyclibpgsql.cpython-36.pyclwpgsrvadm.cpython-36.pyclibpgsql.pylwpgsrvadm.pyutil.pyvirtualenv.gitignorebinactivateactivate.cshactivate.fishactivate.nuactivate.ps1activate_this.pypippip-3.6pip-3.6-script.pywpip-script.pywpip3pip3-script.pywpip3.6pip3.6-script.pywpythonpython3python3.6run-with-local-pythonwheelwheel-3.6wheel-3.6-script.pywwheel-script.pywwheel3wheel3-script.pywwheel3.6wheel3.6-script.pywlibpython3.6site-packagesOpenSSLSSL.py__init__.py_util.pycrypto.pydebug.pyrand.pyversion.pyPyMySQL-1.0.2.dist-infoINSTALLERLICENSEMETADATARECORDREQUESTEDWHEELtop_level.txt_distutils_hack__init__.pyoverride.py_virtualenv.pth_virtualenv.pydistutils-precedence.pthpippip-21.3.1.dist-infoINSTALLERLICENSE.txtMETADATARECORDWHEELentry_points.txttop_level.txtpip-21.3.1.virtualenv__init__.py__main__.py_internal__init__.pybuild_env.pycache.pycli__init__.pyautocompletion.pybase_command.pycmdoptions.pycommand_context.pymain.pymain_parser.pyparser.pyprogress_bars.pyreq_command.pyspinners.pystatus_codes.pycommands__init__.pycache.pycheck.pycompletion.pyconfiguration.pydebug.pydownload.pyfreeze.pyhash.pyhelp.pyindex.pyinstall.pylist.pysearch.pyshow.pyuninstall.pywheel.pyconfiguration.pydistributions__init__.pybase.pyinstalled.pysdist.pywheel.pyexceptions.pyindex__init__.pycollector.pypackage_finder.pysources.pylocation�x�������������x�����Xt
sr�?64 ax������������U2/si�$����������������
�U�~�U
�lptrorusksvtrukzhzh2.2.20-4.el8_102.2.20-4.el8_102.2.20-4.el8_102.2.20-4.el8_102.2.20-4.el8_102.2.20-4.el8_10
1.2.0-11.4.10
	

 !"#$%&'()*+,-./0123456789:;<=>>>>>>>>>>>>>>>>??@@@gnupggpgconf.confdirmngrdirmngr-clientg13gpggpg-agentgpg-connect-agentgpg-wks-servergpg-zipgpg2gpgconfgpgparsemailgpgsplitgpgvgpgv2watchgnupg.build-id077f681871652147bab2a229280dc1d582e604d7116b84f65130040a8812080fefc4362cd299233f126a46b12be6d5c43e2679908a2a18fabc0a7a4d1e7967ef5d441bf2298b827b2c02938715e9bce251c04d6bdb70b112e2d953b4591bb8c19365b9de58bcef962067cfbedfeff0e7512e4914e83323c26fcb7c056d333116ab69654696f22e0f069826348f94b0f99bef2d19dce8ea978f076c5faf8d8a3aadc9de06b2fa4cd4ef6bfc85374fa675ccf1e75fb05f795d42829190efc7bcefe9018796bffa706fbfff98c7d37f4fcffb2c915f9c44a43fd7140839c2647bae4e9a6ec728ed365ccf8d41ec95f6975eeddf1ba636dd04fd934e1060d674b1d6729ba6c48f7d6ae3c260e1f2e17e0c899956c09a5e53f5ca594e8bffaaebb02f3564513643fa445c4c1786d2c0e5224e1d84ae06dcbeb95eaf633d26a4d0d3d5f360240cba3640cf2e753e5305879afba427dd7c3074365202761fc979decc79ecb87ed84915f0c6869b72555fe9d01cedb60916b5d411fe22e6dirmngr.servicedirmngr.socketgpg-agent-browser.socketgpg-agent-extra.socketgpg-agent-ssh.socketgpg-agent.servicegpg-agent.socketdirmngr_ldapgpg-check-patterngpg-preset-passphrasegpg-protect-toolgpg-wks-clientscdaemonaddgnupghomeapplygnupgdefaultsg13-syshelpgnupg2AUTHORSDCODETAILSFAQHACKINGKEYSERVERNEWSOpenPGPREADMETHANKSTODOTRANSLATEexamplesREADMEdebug.prfgpgconf.confpwpattern.listscd-eventsystemd-userREADMEtrustlist.txtvsnfd.prfgnupgdistsigkey.gpghelp.be.txthelp.ca.txthelp.cs.txthelp.da.txthelp.de.txthelp.el.txthelp.eo.txthelp.es.txthelp.et.txthelp.fi.txthelp.fr.txthelp.gl.txthelp.hu.txthelp.id.txthelp.it.txthelp.ja.txthelp.nb.txthelp.pl.txthelp.pt.txthelp.pt_BR.txthelp.ro.txthelp.ru.txthelp.sk.txthelp.sv.txthelp.tr.txthelp.txthelp.zh_CN.txthelp.zh_TW.txtsks-keyservers.netCA.pemgnupg.info-1.gzgnupg.info-2.gzgnupg.info.gzgnupg2COPYINGgnupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.mognupg2.modirmngr-client.1.gzgpg-agent.1.gzgpg-connect-agent.1.gzgpg-preset-passphrase.1.gzgpg-wks-client.1.gzgpg-wks-server.1.gzgpg.1.gzgpg2.1.gzgpgconf.1.gzgpgparsemail.1.gzgpgtar.1.gzgpgv.1.gzgpgv2.1.gzscdaemon.1.gzsymcryptrun.1.gzwatchgnupg.1.gzgnupg.7.gzgnupg2.7.gzaddgnupghome.8.gzapplygnupgdefaults.8.gzdirmngr.8.gz/etc//etc/gnupg//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/07//usr/lib/.build-id/11//usr/lib/.build-id/12//usr/lib/.build-id/1e//usr/lib/.build-id/51//usr/lib/.build-id/58//usr/lib/.build-id/6f//usr/lib/.build-id/8f//usr/lib/.build-id/ad//usr/lib/.build-id/b0//usr/lib/.build-id/bf//usr/lib/.build-id/c2//usr/lib/.build-id/c4//usr/lib/.build-id/ca//usr/lib/.build-id/d2//usr/lib/.build-id/dd//usr/lib/.build-id/f0//usr/lib/systemd/user//usr/libexec//usr/sbin//usr/share/doc//usr/share/doc/gnupg2//usr/share/doc/gnupg2/examples//usr/share/doc/gnupg2/examples/systemd-user//usr/share//usr/share/gnupg//usr/share/info//usr/share�x������������������Xu
ti�?ty l�����������������4de o�$}����������������
�4�4�4
��1hh	 H� �B��@C0Q�x���
~�x��8/��
a�OW�43:�m��E!����
�lw��PW
@�K��7)!�"Ob$g#9�"-
.:'%'��,�!!#
B�
B�c�
F�
?�&
@�DU
E^
^
Zf
B`��
F�
\�
K�L�fk]��*R
@Z
@%
B�
Kq
F�
|"
I,
A�
FU
C4
f�����A큤A큤�������������������������A�A�A�A���A�A�A�A�A�A�A�A�A�A�A���A�A�A�A���A�A�A�A�A�A�A�A�A�A���A�A�A�A�A�A���A�A�A���A�A�A���A�A�����A�A�A�A�A�A�A�A�A�A�A�A���A���A�A�A���A���A�A�A�A�����A�A�A�A�A�A�A�A�A�A�������A�A큤A�����������A��������������������������������������������������������������A큤����������������������������������������������������A��A���������������������������A��A�큤A��A���A�큤A��A��A��A�큤��A��A��A�큤������������A�A���A��A��A��A��A��A��A��A��A�큤A�A�A�A�_��w_���_��w_��w_��w_��w_��w_��~_��}_��_��}_��_��~_��}_��~_��~_��}_��~_��}_��}_�� _�� _��~_�� _�� _��~_��~_��~_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_�� _�� _�� _��j_��j_��|_���_��~_���_��~_���_��~_���_���_��~_��|_���_���_���_��~_���_���_��~_���_���_���_��~_���_���_��~_���_���_��~_��~_���_���_��~_���_��~_��~_���_��~_���_��~_��~_��~_��~_��~_���_��~_���_��~_���_��~_���_��~_��~_��~_���_��~_���_��~_���_���_���_��~_���_��~_���_���_��~_���_��~_���_��~_��~_���_��~_���_���_��b_��5_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��l_��*_��m_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��|_��l_��*_��k_��*_��|_��k_��*_��k_��*_��|_��l_��*_��|_��l_��*_��k_��*_��k_��*_��k_��*_��|_��_��l_��*_��l_��*_��l_��*_��|_�� _��|_��|_��|_��|_��|_��k_��k_��*_��*_��l_��*_��l_��*_��l_��*_��l_��*_��l_��*_��k_��*_��k_��*_��l_��*_��l_��*_��_��a_��a_��a_��a7beb572566b330a057ca9d16e978b7c8fda07e3113a0ed73fd2629b8dbaf5d785ae333ef3d21b560f0f1c5bd4cb455114eb6e293f1f4a989a8cea29105e1c2a9febb8532f3a83e194e8869b828c7faba29264f69c943518879d7550afe2c5e3a10e9443ef8b6840ecca62ece7630c29724c9157b8826bbbcf5d62358041ef9f953f145356c8e882b7e40cf7d4d7c0cf3ac3aa849247cdf56ffd7500d3165d7d2c138df9c5c5653a4492ab1cdf7de89dcf2f255427726f34db7af378a573401135fd284d210501f9b6�x�������������hx����Xv
eds?roje��������H0������]EC3R�$M����������������
]E^E\E
�of mountpoints that the kernel reports as "/"- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Fix sesearch handling- Fix a1 handling- Update to upstream
  2009-7-15 Dan Walsh <dwalsh@redhat.com> 
  - Fix handling of syscall record a1 field
  - Translate "/" to mountpoint when returned by kernel- Update to upstream
  2009-7-07 Thomas Liu <tliu@redhat.com> 
  - Fixed detail doc not clearing when deleting all alerts
  - Hid notify check when deleting all alerts.- Fix locate code to use os.lstat- Update to upstream
  2009-7-01 Thomas Liu <tliu@redhat.com> 
  - Fixed browser behavior when there are no alerts
  - Fixed seapplet behavior when there are no alerts
  - Made delete all button delete alerts on server side and on local side- Add open access to audit_data.py define statements- Update to upstream
  2009-6-25  Thomas Liu <tliu@redhat.com>
  - Added a "Copy to Clipboard" button to the browser GUI.- Add sesearch- Fix handling of last seen
- Add open_with_write check- Update to upstream
  * Thomas Liu <tliu@redhat.com>
  Bug fixes to GUI, added Delete All Alerts menu item.- Update to upstream
  * New Gui- Fix handling of PATH with locatepwd- Redesign of GUI- Fix handling of PATH- Fix crash when gathering stats- Make sure setroubleshoot exists after 10 seconds- Change multiple signatures from exception to warning
- Update links on fedorahosted.org- Fix sealert segfault- Stop sending messages with scon or tcon == setroubleshootd_t- Split out documentation- Stop logging on normal shutdown of sedispatch- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Fix cpu utilization problems
- Save database on exit- make sure setroubleshoot is running when using sealert -l- sedispatch needs to connect to dbus on avc arrival, 
  instead of startup, since the dbus daemon is not started 
  when sedispatch starts- Fixes missing dbus config files- Switch to C Based applet
- Use dbus for messaging.  Only run setroubleshoot when- Rebuild for Python 2.6- Update to upstream
  - 2008-10-06  Dan Walsh <dwalsh@redhat.com>
  - remove .png from desktop files- Update to upstream
  - 2008-10-22    <jdennis@redhat.com>
    - Fix pruning code
    - Fix time stamps- Fix requires line to gnome-python2-gnome- Fix startup problems- Fix setroubleshoot init to rely on messagebus being running- Fix spelling mistakes
- Update translations- add dialog to run a command in the background, capture it's stdout & stderr
    report it's status, kill it, and pass it a pseudo terminal for password prompts
    - separate the fix command into it's own section in formatted alerts
    - add UI for running the fix command, enable only if there is a single selection
      and the selected alert has a fix command
      - add a config parameters 'run_fix_cmd_enable' to control if fix commands
      can be run, defaults to False
      - Resolve bug 431380: prevent notify popups while setroubleshoot is open- allow sealert -l lookup to accept * wildcard
- add a few more audit fields needing special decode handling- Resolve bug 430421: audit_listener_database.xml:3029: parser error in xmlParseDoc()
  rewrite the audit_msg_decode logic to beaware of specific audit fields
- add new template substitution $SOURCE, a friendly name, $SOURCE_PATH still exists
  and is the full path name of $SOURCE, also add 'source' attribute in AVC class,
  fix how source and source_path are computed from audit's comm and exe fields
- fix the computation of tpath to also look at the audit name field, formerly
  it had only been looking at path, fixes <Unknown> showing up for many targets
- add exception handling around xml file writes (Alan Cox reports problem when /var is full)
- add testing documentation
- Resolve bug 430845: obsolete URL in setroubleshoot package description
- Resolve bug 428960: Permissive message makes no sense.
- init script now allows extra test options
- show_browser() now opens and raises the window (e.g. presents) rather than just
  assuring it's realized (e.g. iconified, or hid�x��������������g����Xw
na�?sing���������q����_Gs w�$����������������
�_�__
�9_Mass_Rebuild- remove missing-ipv6-not-fatal.patch because the concerning code is later
  removed with getifaddrs.patch- Make sure range6 is correct for subnet6 where it's declared (#902966)- simplify the previously added triggerun scriptlet- during update convert DHC*ARGS from /etc/sysconfig/dhc*
  to /etc/systemd/system/dhc*.service (#895475)
- 12-dhcpd NM dispatcher script now restarts also dhcpd6 service- 4.2.5- run %check in Fedora only, there's no atf package in RHEL- don't package ancient contrib/* files- 4.2.5rc1
  - added %check - upstream unit tests (Automated Test Framework - ATF)- fix two resource leaks in lpf-ib.patch- add After=time-sync.target to dhcpd[6].service (#878293)
- remove groff from BuildRequires (no idea why it's been there)- multiple key statements in zone definition causes inappropriate error (#873794)- fix path to dhcpd6.leases in dhcpd6.conf.sample (#870458)- dhcpd needs to chown leases file created before de-rooting itself (#866714)- rebuild against new bind-libs-lite- do-forward-updates statement wasn't recognized (#863646)- dhclient-usage.patch+part of manpages.patch merged with dhclient-options.patch- 4.2.4-P2: fix for CVE-2012-3955 (#856770)- SystemD unit files don't use Environment files any more (#850558)
- NetworkManager dispatcher script doesn't use DHCPDARGS any more- fixed SPEC file so it comply with new systemd-rpm macros guidelines (#850089)- dhclient-script: fixed CONFIG variable value passed to need_config (#848858)
- dhclient-script: calling dhclient-up-hooks after setting up route, gateways 
                   & interface alias (#848869)- don't build libdst, it hasn't been used since 4.2.0 (#849166)- isc_time_nowplusinterval() is not safe with 64-bit time_t (#662254, #789601)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Dhclient does not correctly parse zero-length options in 
  dhclient6.leases (#633318)- 4.2.4-P1: fix for CVE-2012-3570 CVE-2012-3571 and CVE-2012-3954 (#842892)- ib.patch: added fall-back method (using ioctl(SIOCGIFHWADDR)) when getting
            of HW address with getifaddrs() fails (#626514-c#63, #840601).- Dhcpd does not correctly follow DhcpFailOverPeerDN (#838400)- allow dhcpd to listen on alias interfaces (#840601)- changed list of %verify on the leases files (#837474)- define $SAVEDIR in dhclient-script (#833054)- 4.2.4- return prematurely removed 12-dhcpd (NM dispatcher script) (#828522)- getifaddrs.patch: use HAVE_SA_LEN macro- 4.2.4rc2- dhcpd.service: explicitly add -cf to indicate what conf file we use (#819325)
- no need to copy /etc/*.conf to /etc/dhcp/*.conf in %prep anymore- 4.2.4rc1- remove inherit-leases.patch - it's probably not needed anymore (#815355)- update paths.patch and source URL- 4.2.4b1: noprefixavail.patch merged upstream- move dhclient & dhclient-script from /sbin to /usr/sbin- one more fix (#806342)- improve #449946 fix (#806342)- RFC5970 - DHCPv6 Options for Network Boot (#798735)- don't use fallback_interface when releasing lease (#800561)- use getifaddrs() to scan for interfaces on Linux (#449946)- don't send log messages to the standard error descriptor by default (#790387)- -timeout option (command line) with value 3 or less was driving dhclient mad (#789719)- dhclient-script: install link-local static routes with correct scope (#787318)- rebuild for new bind-libs-lite- revert previous change (#782499)
- remove the rest of the sysvinit scriptlets- use PrivateTmp=true in service files (#782499)- 4.2.3-P2: fix for CVE-2011-4868 (#781246)
- clean up old Provides and Obsoletes- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- revert change made in 4.2.3-3 because of failing failover inicialization (#765967)
  the procedure is now:
  init lease file, init failover, init PID file, change effective user/group ID
- don't need to fix lease files ownership before starting service
- dhclient-script: allow static route with a 0.0.0.0 next-hop address (#769463)- hopefully we don't need 12-dhcpd anymore as 'After=�x�������������XW����Xx
r �?- R�����PI������:edor�$����������������
:x�
/
���������������xsgbVQE@4/#

���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#





�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>9-(���������������~rma\PK?:.)���������������snb]QL@;/ Kysela) [1683051��Fh|s
�
g���=
�
�|�\_�

���Ue�
�
�|�_��
����2��
�
t�mh��
�
Wl>t
�
ۋ&pL+
����%$$
�
Wl�@@
�
@'54
�WlQk
�
���VH1
�
�|�z��<
�=��]k�&
�
"^�?�#
��-���=
�ۋ�o��
����08
�
+
�{�0!
�
"^���\
���p�h�*
�������
�
+
�D�t#
�
���g��
��|��Q

��g�*
�h

�O;����


�
�#2�6H�
�K=X`�p
�O;�+$�_
�
�Y�&�L%
��6�m��

���O{��v
�
��S���
�K=�`�,
���O��w

�
Z_��B

�
b�3C��H
��|�W-�3
�K=�`�7
���cW�H
��/?�e�
��+k�H
��/?���C
���O��y
�
�+�t�,
��_|�\�
�K=YaL)
��M�RdC
��+�?
���!8��W
�����+8_
��F�l�4
��$��A�"
�
�+|��d
��i�T�l�
��F�
H�
�'�w"
��

��$��A4N
�
�+(�0
���j�x)
��FT�L�
��$ټA�U
�
�+TqD
�N����h>
��Fڰ�*
��$٭A�4
�
�+�t�B
��$�x7
��F���
��0E�>t{
�
�+xc�
�xC8
��W
��FN;�D
��+]qP7
��|��@�=
�ۋ�V:
��$�hX
�p�L��
�l*����
��+kq�%
�kۍu��i
�l*����
��+���
�l*�mj�
��+9
�2
��$�P 
�l*��j��
��S�)r��

��+P
l3
�ۋ\��6
�l*��jh�
����q�|I
�
�S��r��

��$��:(Z
�
�+^
�0
��$��
�
���&���
�l*�	k��
��+k
X,
����Ĭ
�D�^0�
�]�����Y
�	�+�r�/
�D��0<�
������C
�D��0��
�|�J\;
}�$ٌ�$
}D��0d�
{�$�z(
yD�#1��
w]�K"
�)
vD���?
s0��b�0
r
]�����1
r	D��%
o�$�5\-
mD���1
k�Q׋6�w
jD��?<u
g�|�#�HD
eۋ?Vl�
eD����?
c0��sa
b
�$��&
a�
�1
$�

_D�����
_]��Vz�-
^	�|�Ը�>
]D�j�lv
[0�
t��
Z
D�H�tn
W|B����

SD�%�x�
S�$٫�/
Q�7}H��
OD���D�
Oۋ(�<?
M����(w
L�*�)��m
KD����h
K�����
HD���L 
G_[�R���
F0�4-$r

F
�|��@8��
CD�7\�
C�$�7�5
AD��\�
?�1��
dL
;D�_I
;0�!�

:
YֈA�
8D�R��
7�|�_
��
6
�$�(#l
6
'�'�=�:
4D���.
3�$�#4V
2
'�'�?4A
0D�1��g
/�$��"�
.
���s,�
,'�'�=G
,D�a��#
+�$��"�*
*
�$ٸB
)�}�  
'D�k�;
'�|��
�n
&
�$ٝhB
%D�o��
#���\�
 D���$
oңj���

�|�;��:

D�K�(
"^��6
oң���f
D��K�
D��K4n
"^��_
�|���e

�$٭
�

+���#��
�|�'<d%


ۋHX0
	�$٩�)

��>hlK
���!�I
�x��������������F����Xy
�%?a>�|�����3�V�/���$,����������������
�V�V�V
�`t`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�`t]�w�`t]�w�`t]�w�`t]�w�]�w�]�w�]�w�`t`t`t`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`t]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�]�w�`tab88a02b01ce646a5a3965a05f1876b70b97b24e4d6409973126a0baa59126a5e7f0630dbf09f3bb3adf3bb8e8d2464afbd6e616fe0075dbef29b7e82bd2a50daebbf3da932436bd2d92507fac0940f83106c6fcd7886dedefa246dede61f747d001767068fe2791a48f829153820a8717f659e08c9a061759cd66e9e37a383311d1fd1f5364ef778eb0edc36b4f1955ca165c1900703f163c1406aa8ae767cdd57bb7e152d9a10de56bd0e22a72eac7787ea8c4319fe2b7a8d632aea1a67f8233b37cb2a14007d745d884b1d2572e9a307b59d12319bad0e494307fd7a9be897d3882ccecb24b1621975fde25fc7e90e5c1c00197cf67820622458f35bb34ae24c54410578e535f6284801c3f1bd342203eb766836bec18b3d40646d165f33d4deb4eb4390d48791e27840e564b4c0737598252101063dc0a5b5471b7968da5f81b1dd7ea373290245651419b61bac751b065ecf89c8f65e18151a5b6af5f2652452b357384d7f06f5bc0a03ece55e633104d8aae970bcd3492105c579a28f8805f42ae3a6ff3c0152879205f5bf6cf46d2ba8cc53529ef2a21d481840a9714dcdd34a1aca546dba1c72da30586bfbb0cbce689f4abad3e594f9872a5f932c299e7e42d639ca932ebb953fa0914b68dd04302e008652b7cee579e6c1a4cd478b26b48de85d159629fa18b9fe5831092309b9631b860561c04fbda7c70c54123ade96d0e9fa4427c48e50ec708407bbd94c1bf4560fd05581391647e5f9ee9bbaf9547fba4003f85913471de89e4d497cd8504ae90a14909816285ab17c2a199f0d444a24488ccc5e905ff5fc0e8190a613c3938851cb14641660c466a98329730c221ba7eaddcb16c5ca7f982a521e552f901adf06002e387f48c301060b751b43af41ae3f50342760c8d7f6a2e53c10b6c04f47cd5f7693cd579b16cbe0395644bd4df8c9a816a871ff5acd5cf47bbccc3a6727b6838d4b22c78d3aa2c2b5115f5476f05ab289dd3cd2cc44d9786a011bf7754a400af8e1c7c678de621167c426427361388fc73a8094fda2cf591e1ae1674332a6acaef62be1ea293e460e285de5df45bfd20e6a41e2d08d7eee56c1b6b5acc75f97e261432284c5a8ed77cd0fc8e398b613067ecc1880cf2e48f88d476705ee679044044acba10d6162e27287bcaaeca49daf5a18fcfd913e3f271fbef2c4327b860c145e8507e5fa45f4d6127f0cfa9cac59b79900d21ac116b8f6708b4bb57812137b511275a7bf65614ca45ee77b81111e721b8f05c4eaec3838b85f1083494a191818bb4ea3f9d5dd0da21977d91df78344906167dba287adbdff60339c48254ad3f71dfb4cae8e212077238e18a2a33ac71b10fbca54f6ab8e60d58d9ec96a0bfa23e8eabee711956f59a35cf325f9df41959249385c51b93aa207dfbc1c2529f0f50c3ff43c05a1863850244702ea392f679e20b2765402936e38fb47e65ec445c7ff8ad2ab37348b5f943d1cbdb478778bc86ee42db6fc01e29a9ccaa12888628b8c9f749527a2e5f9154a1dd5471�x�������������H6����Xz
-x?e us`��Q�������4re f�$-����������������
�4�4
�H0�?+ld
�
�

�
�
�	 
�	J
�
<
�
@
�
p
�
t
�
y
�

�
�
�	
�
�
�
�
�
�
�

�@	f
��k
��+�
��L�	�(	�
8	�<9
�<:�<G$�H$�I%X%0Y%D\%h]%�^&�	b'�
d(�
e(�
f(�
l(�
t)u)Pv)�w*Dx*�y*��+
�+ 
�+&
�+h


+|

+�6
-�
-�6

/�

0%
�0h

0l0�
g0�
h0�
Cperl-Error0.170252.el8
Error/exception handling in an OO-ish wayThe Error package provides two interfaces. Firstly Error provides a
procedural interface to exception handling. Secondly Error is a base class
for errors/exceptions that can either be thrown, for subsequent catch, or
can simply be recorded.`|pdord1-prod-a64build002.svc.aws.rockylinux.org
�KojiRocky(GPL+ or Artistic) and MITinfrastructure@rockylinux.orgUnspecifiedhttp://search.cpan.org/dist/Error/linuxnoarch)	g�
�
�
��
~PY��a(FA큤��A큤A큤����������A큤����A큤��`|pcY�TY�TY�TY�TY�TY�TY�TY�TY�TY�TY�T`|pdY�T`|pb`|pb`|pc`|pb`|pb30bd41fa698333ac0f5a8f7ff955b1369dfedc61c28e3faa963e0e40546b09df12239aed1f50b84b5363303617b07a91ad8db09964e2776554f261e350816ed14c57aee7675d540f1366ed93b58f529d5ca2f18f5221f620548323cbcd13b81017e77132008362bf518fa3cf086a98d3227b16705f622c1f3783ddadccb8eb5139694713c1010420fd2817560175c38bfa964c9f56317b87a0539d6551443ea6dda1e7076beb323c5e9647b2edd53f1e5c547f3f117fbe5fc2cf2aae0dd828a96ad20f91a21c58c6935cb23db63f94583d11827018a1b24f95b873519cc564d1fd9c0fa40281a509181f0ba894d3f75c760bd832841c3c30cba798576a1808dc08beb5075f0c5f970262ed2b45707619c46e671b41382fef71a953b2bef09f7ccbfeb2e3998b95512198f7d61d51cd0a451454a599ed84baaa9bfab646dfa158adc4fefa4b45ad3cad05a71a1d9ce244ef782359e9e312807aa6b12c7e16aeac524028a2b3f0c16c86db724b5c15bee0cbe5ba79505214f3e7da8aa45f2913eec9b8d1a8a040bb542ca85c5d043826bc490f7b5b1159670f9f8fe28683b90db715865033095081f81fec853a89bc62d4e7f89de3936aa21005a4e42197fabfe1�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-Error-0.17025-2.el8.src.rpm����������������������������������������������������������������������������perl(Error)perl(Error::Simple)perl(Error::WarnDie)perl(Error::subs)perl-Error@@@@@@@@







perl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(Carp)perl(Error)perl(Exporter)perl(Scalar::Util)perl(overload)perl(strict)perl(vars)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)5.4.03.0.4-14.6.0-14.0-15.2-14.14.3Z|;�Y���Yy�Y7�Y3�@X���W<Y@W8d�V�=@U���Ux&�Uq�@Uj��Tܕ�T
�@S��@S���R��@RM\@Rq@Q��Q��@Q�I�Q�P�@P	H@O�@OЗ�OЗ�O�M�6@MQ0@M	�@K��K��@KTM@K�@Jj�I��@H�L@HA=�G�O�G��G�@GUA@ECF@E6@E'��E#�@D�@D��D��@D��@D���DR�DF&@C���C��BS�@@ɞ�Fedora Release Engineering <releng@fedoraproject.org> - 1:0.17025-2Paul Howarth <paul@city-fan.org> - 1:0.17025-1Fedora Release Engineering <releng@fedoraproject.org> - 1:0.17024-11Ji�x��������������%����X{
er�?- Re�	�C���{_rom �$k����������������
{_|_z_
�schema in /etc/openldap/schema (#330471)
- Remove manpages patch and keep modified man pages as Source files
- Improve dhclient.8 man page to list options in a style consistent
  with most other man pages on the planet
- Upgrade to latest dhcp LDAP patch, which brings in a new dhcpd-conf-to-ldap
  script, updated schema file, and other bug fixes including SSL support for
  LDAP authentication (#375711)
- Do not run dhcpd and dhcrelay services by default (#362321)- libdhcp4client-devel requires openldap-devel- Rename Makefile.dist to Makefile.libdhcp4client
- Spec file cleanups
- Include stdarg.h in libdhcp_control.h- Remove chkconfig usage for ypbind in dhclient-script (#351211)
- Combine dhcp-static and dhcp-devel packages since there are no shared
  libraries offered
- Remove Requires: openldap-devel on dhcp-devel and libdhcp4client-devel
- Make libdhcp4client-devel require dhcp-devel (for libdhcp_control.h)
- Do not make dhcp-devel require the dhcp package, those are independent- Install libdhcp_control.h to /usr/include/isc-dhcp/libdhcp_control.h
- Update libdhcp4client patch to use new libdhcp_control.h location
- Remove __fedora_contrib/ subdirectory in /usr/share/doc/dhcp-3.1.0,
  install those docs to /usr/share/doc/dhcp-3.1.0- Remove ISC.Cflags variable from libdhcp4client.pc- Fix 'restart' mode in init script (#349341)- Upgrade to ISC dhcp-3.1.0
- Remove unnecessary /usr/include/dhcp4client/isc_dhcp headers
- Make sure restorecon is run on /var/lib/dhcpd/dhcpd.leases (#251688)
- Install dhcp.schema to /etc/openldap/dhcp.schema (#330471)- Init script fixes (#320761)
- Removed linux.dbus-example script since we aren't using dhcdbd now
- Remove dhcdbd leftovers from dhclient-script (#306381)- In dhcp.conf.5, explain that if no next-server statement applies to the
  requesting client, the address 0.0.0.0 is used (#184484).- Init script fixes for dhcpd and dhcrelay (#278601)- Fix typos in ldap.c and correct LDAP macros (#283391)- Do not override manually configured NTP servers in /etc/ntp.conf (#274761)- Remove the -x switch enabling extended new option info.  If given to
  dhclient now, it's ignored.- use a new macro name vendor -> vvendor to not overwrite the
  RPMTAG_VENDOR setting- Upgrade to ISC dhcp-3.0.6
- Remove the -TERM option from killproc command (#245317)- For init script functions, echo new line after OK or FAIL msg (#244956)- BOOTP_BROADCAST_ALWAYS is not the same as ATSFP, fixed
- Added anycast mac support to dhclient for OLPC- Disable -fvisibility=hidden for now as it breaks dhcpv4_client() from
  the shared library (#240804)- Init script fixes (#237985, #237983)
- Reference correct scripts in dhclient-script.8 man page (#238036)- Rename -devel-static packages to -static (#225691)- Added missing newline on usage() screen in dhclient- Spec file cleanups (#225691)
- Put libdhcpctl.a and libomapi.a in dhcp-devel-static package
- Put libdhcp4client.a in libdhcp4client-devel-static package- Enable Xen patch again, kernel bits present (#231444)- Spec file cleanups (#225691)- Remove Xen patch (#235649, from RHEL-5, doesn't work correctly for Fedora)- Ensure that Perl and Perl modules are not added as dependencies (#234688)
- Reorganize patches by feature/bug per packaging guidelines (#225691)
- Move the following files from patches to source files:
     linux.dbus-example, linux, Makefile.dist, dhcp4client.h, libdhcp_control.h
- Compile with -fno-strict-aliasing as ISC coding standards generally don't
  agree well with gcc 4.x.x- Fix formatting problems in dhclient man page (#233076).- Man pages need 0644 permissions (#222572)- Include contrib/ subdirectory in /usr/share/doc (#230476)
- Added back Requires for perl since dhcpd-conf-to-ldap needs it (#225691)
- Put copies of dhcp-options and dhcp-eval man pages in the dhcp and
  dhclient packages rather than having the elaborate symlink collection
- Explicitly name man pages in the %files listings
- Use the %{_sysconfdir} and %{_initrddir} macros (#225691)
- Use macros for commands in %build and %instal�x�������������8����X|
 <�?at]dm������J�Jaro�$Z����������������
J�I�K�
�dasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.2.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.1.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.5.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.4.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.3.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.2.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.1.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.3-0.3.m13Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.3-0.1.m13Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.15-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-2Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-5Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-4Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-2 Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-9Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-8Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-7Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-6Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-5Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-4Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-2Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-1Joerg Bruehe <joerg.bruehe@oracle.com>Bjorn Munch <bjorn.munch@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Brajmohan Saxena <brajmohan.saxena@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Daniel Fischer <daniel.fischer@oracle.com>Tor Didriksen <tor.didriksen@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Daniel Fischer <daniel.fischer@oracle.com>Chuck Bell <chuck.bell@oracle.com>Sunanda Menon <sunanda.menon@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Georgi Kodinov <georgi.godinov@oracle.com>Georgi Kodinov <georgi.godinov@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@sun.com>Jonathan Perkin <jonathan.perkin@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Magnus Blaudd <mvensson@mysql.com>Alexander Nozdrin <alexander.nozdrin@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent.boortz@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Timothy Smith <tim@mysql.com>Joerg Bruehe <joerg@mysql.com>�x������������������X}
 9�?4- h�0����Wk Han�$G����������������
WkVk
�F$x?hd
�
�
�
�	
�	?
�
8
�
<
�
l
�
p
�
u
�
{
�

�	
�
�
�
�
�

�
�	
�

�
�R
T\fp
����F(c
8l-9 -:
-B�
G�H�I�X�YZ
[
\]$^G
b^
d�
e�
f�
l�
t�uv
�
�
�"
�d


x

|6
!�
!�6

#�

$!
�$d

$h$l
g$p
h$t
Cpython-rpm-macros345.el8The unversioned Python RPM macrosThis package contains the unversioned Python RPM macros, that most
implementations should rely on.

You should not need to install this package manually as the various
python?-devel packages require it. So install a python-devel package instead.dB�ord1-prod-x86build003.svc.aws.rockylinux.org�KojiRockyMITinfrastructure@rockylinux.orgUnspecifiedlinuxnoarchv
o����dB�dB�ab71b9a3dc3874c8a247502bd2d2c69a32d8258e7b4e178d78e976d2f2bb07b218f3d9d4bdc42804915c2ab6f3d786aeb29ad35472b300036c398ffb1e47ba9frootrootrootrootpython-rpm-macros-3-45.el8.src.rpm��������python-macrospython-rpm-macros







python-srpm-macrosrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.14.3c��cIO@b��@b�@`�@`2@^�@]�c@\�@\�@[��@[L��[E�@[D��[3|@[+�@Z��Z�a@Z��@Z}�@Za�ZO�Y��@Y���Yy�X�Z�X��X���X��@X~@X6�@X,J@X,J@X*��W��@W��W5��W4p@V�=@V���V���V�<@V�S@V�^�V��@Miro Hrončok <mhroncok@redhat.com> - 3-45Charalampos Stratakis <cstratak@redhat.com> - 3-44Tomas Orsava <torsava@redhat.com> - 3-43Miro Hrončok <mhroncok@redhat.com> - 3-42Lumír Balhar <lbalhar@redhat.com> - 3-41Lumír Balhar <lbalhar@redhat.com> - 3-40Charalampos Stratakis <cstratak@redhat.com> - 3-39Charalampos Stratakis <cstratak@redhat.com> - 3-38Miro Hrončok <mhroncok@redhat.com> - 3-37Miro Hrončok <mhroncok@redhat.com> - 3-36Tomas Orsava <torsava@redhat.com> - 3-35Tomas Orsava <torsava@redhat.com> - 3-34Tomas Orsava <torsava@redhat.com> - 3-33Tomas Orsava <torsava@redhat.com> - 3-32Tomas Orsava <torsava@redhat.com> - 3-31Tomas Orsava <torsava@redhat.com> - 3-30Tomas Orsava <torsava@redhat.com> - 3-29Tomas Orsava <torsava@redhat.com> - 3-28Miro Hrončok <mhroncok@redhat.com> - 3-27Fedora Release Engineering <releng@fedoraproject.org> - 3-26Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 3-25Tomas Orsava <torsava@redhat.com> - 3-24Ville Skyttä <ville.skytta@iki.fi> - 3-23Tomas Orsava <torsava@redhat.com> - 3-22Fedora Release Engineering <releng@fedoraproject.org> - 3-21Michal Cyprian <mcyprian@redhat.com> - 3-20Michal Cyprian <mcyprian@redhat.com> - 3-19Fedora Release Engineering <releng@fedoraproject.org> - 3-18Michal Cyprian <mcyprian@redhat.com> - 3-17Tomas Orsava <torsava@redhat.com> - 3-16Orion Poplawski <orion@cora.nwra.com> 3-15Orion Poplawski <orion@cora.nwra.com> 3-14Orion Poplawski <orion@cora.nwra.com> 3-13Orion Poplawski <orion@cora.nwra.com> 3-12Orion Poplawski <orion@cora.nwra.com> 3-11Orion Poplawski <orion@cora.nwra.com> 3-10Orion Poplawski <orion@cora.nwra.com> 3-9Jason L Tibbitts III <tibbs@math.uh.edu> - 3-8Fedora Release Engineering <releng@fedoraproject.org> - 3-7Orion Poplawski <orion@cora.nwra.com> 3-6Orion Poplawski <orion@cora.nwra.com> 3-5Orion Poplawski <orion@cora.nwra.com>�x�������������(�����X~
> b?:4.3��������`j��������pope�$,����������������
������
�ges- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache�x�������������������X
vm#?c: F���������9�������rect�$&����������������
���
�ase Engineering <releng@fedoraproject.org> - 1.0.11-3Neal Gompa <ngompa13@gmail.com> - 1.0.11-2Remi Collet <remi@fedoraproject.org> - 1.0.11-1Remi Collet <remi@fedoraproject.org> - 1.0.10-1Remi Collet <remi@fedoraproject.org> - 1.0.9-1Remi Collet <remi@fedoraproject.org> - 1.0.8-1Fedora Release Engineering <releng@fedoraproject.org> - 1.0.5-2Christopher Meng <rpm@cicku.me> - 1.0.5-1Christopher Meng <rpm@cicku.me> - 1.0.3-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.0.2-2Christopher Meng <rpm@cicku.me> - 1.0.2-1Christopher Meng <rpm@cicku.me> - 1.0.1-1Christopher Meng <rpm@cicku.me> - 1.0.0-1Christopher Meng <rpm@cicku.me> - 0.7.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.1-2Christopher Meng <rpm@cicku.me> - 0.6.1-1Christopher Meng <rpm@cicku.me> - 0.6.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.5.0-2Christopher Meng <rpm@cicku.me> - 0.5.0-1Christopher Meng <rpm@cicku.me> - 0.4.5-3Christopher Meng <rpm@cicku.me> - 0.4.5-2Christopher Meng <rpm@cicku.me> - 0.4.5-1Christopher Meng <rpm@cicku.me> - 0.4.2-2Christopher Meng <rpm@cicku.me> - 0.4.2-1- Security: `crypto_core_ed25519_is_valid_point()` now properly
  rejects small-order points that are not in the main subgroup
  CVE-2025-69277- Rebuilt for https://fedoraproject.org/wiki/Fedora_31_Mass_Rebuild- update to 1.0.18- Rebuilt for https://fedoraproject.org/wiki/Fedora_30_Mass_Rebuild- update to 1.0.17- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- missing BR on C compiler
- drop ldconfig scriptlets- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- update to 1.0.16- update to 1.0.15
- soname bump to 23
- manage update from libsodium23 (3rd party repository)- update to 1.0.14
- manage update from libsodium-last (3rd party repository)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- update to 1.0.13- update to 1.0.12- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Add static library subpackage- update to 1.0.11- update to 1.0.10- update to 1.0.9- update to 1.0.8
- soname bump to 18
- fix license management- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Update to 1.0.5- Update to 1.0.3- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Update to 1.0.2- Update to 1.0.1- Update to 1.0.0- Update to 0.7.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Update to 0.6.1- Update to 0.6.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Update to 0.5.0- Disable silent build rules.
- Preserve the timestamp.- Add doc for devel package.
- Add support for EPEL6.- Update to 0.4.5- Drop useless files.
- Improve the description.- Initial Package.libsodium23







�1.0.18-9.el81.0.18-9.el8
1.0.18
.build-idbb4bc3b59a5792c948a033a1ec118b118a04c2c2libsodium.so.23libsodium.so.23.3.0libsodiumLICENSE/usr/lib//usr/lib/.build-id//usr/lib/.build-id/bb//usr/lib64//usr/share/licenses//usr/share/licenses/libsodium/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu

directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=bb4bc3b59a5792c948a033a1ec118b118a04c2c2, strippedASCII textPR
R	RRRRRRRRR
https://bugz.fedoraproject.org/libsodiumutf-8841a4a98456f77ec20ce3d629d079c9dbf737635d154bed4810e7�x������������������X�
fw�?r@re�p����ԞIgo�$D����������������
ԞӞ՞
�bdir after Max build to get ndb binaries
- added packages for ndbcluster storage engine- replaced obsoleted "BuildPrereq" with "BuildRequires" instead- enabled the "Federated" storage engine for the max binary- ISAM and merge storage engines were purged. As well as appropriate
  tools and manpages (isamchk and isamlog)- enabled the "Archive" storage engine for the max binary
- enabled the "CSV" storage engine for the max binary
- enabled the "Example" storage engine for the max binary- MySQL-Max now requires MySQL-server instead of MySQL (BUG 3860)- do not link statically on IA64/AMD64 as these systems do not have
  a patched glibc installed- Added libmygcc.a to the devel subpackage (required to link applications
  against the the embedded server libmysqld.a) (BUG 4921)- Added EXCEPTIONS-CLIENT to the "devel" package- disabled OpenSSL in the Max binaries again (the RPM packages were the
  only exception to this anyway) (BUG 1043)- fixed server postinstall (mysql_install_db was called with the wrong
  parameter)- added mysql_tzinfo_to_sql to the server subpackage
- run "make clean" instead of "make distclean"- added ncurses-devel to the build prerequisites (BUG 3377)- when using gcc, _always_ use CXX=gcc
- replaced Copyright with License field (Copyright is obsolete)- added myisam_ftdump to the Server package- link the mysql client against libreadline instead of libedit (BUG 2289)- marked /etc/logrotate.d/mysql as a config file (BUG 2156)- fixed file permissions (BUG 1672)- made testing for gcc3 a bit more robust- added missing file mysql_create_system_tables to the server subpackage- removed dependency on MySQL-client from the MySQL-devel subpackage
  as it is not really required. (BUG 1610)- Fixed BUG 1162 (removed macro names from the changelog)
- Really fixed BUG 998 (disable the checking for installed but
  unpackaged files)- Fixed BUG 959 (libmysqld not being compiled properly)
- Fixed BUG 998 (RPM build errors): added missing files to the
  distribution (mysql_fix_extensions, mysql_tableinfo, mysqldumpslow,
  mysql_fix_privilege_tables.1), removed "-n" from install section.- removed the GIF Icon (file was not included in the sources anyway)
- removed unused variable shared_lib_version
- do not run automake before building the standard binary
  (should not be necessary)
- add server suffix '-standard' to standard binary (to be in line
  with the binary tarball distributions)
- Use more RPM macros (_exec_prefix, _sbindir, _libdir, _sysconfdir,
  _datadir, _includedir) throughout the spec file.
- allow overriding CC and CXX (required when building with other compilers)- re-enabled RAID again- disabled MyISAM RAID (--with-raid)- it throws an assertion which
  needs to be investigated first.- added missing file mysql_secure_installation to server subpackage
  (BUG 141)- re-added missing pre- and post(un)install scripts to server subpackage
- added config file /etc/my.cnf to the file list (just for completeness)
- make sure to create the datadir with 755 permissions- removed unusedql.com>

- Reworked the build steps a little bit: the Max binary is supposed
  to include OpenSSL, which cannot be linked statically, thus trying
  to statically link against a special glibc is futile anyway
- because of this, it is not required to make yet another build run
  just to compile the shared libs (saves a lot of time)
- updated package description of the Max subpackage
- clean up the BuildRoot directory afterwards- Updated Packager information
- Fixed the build options: the regular package is supposed to
  include InnoDB and linked statically, while the Max package
  should include BDB and SSL support- Use more RPM macros (e.g. infodir, mandir) to make the spec
  file more portable
- reorganized the installation of documentation files: let RPM
  take care of this
- reorganized the file list: actually install man pages along
  with the binaries of the respective subpackage
- do not include libmysqld.a in the devel subpackage as well, if we
  have a special "embedded" subpackage
�x�������������������X�
RE?R�������������žR�$R����������������
žÞ
�I�4?�Ld
�
�
�"
�	+
�	M
��
��
�

�

�

�
�
�	
�
�
�
�
�
$
L
	`

t
�
�

@
h
�
�
�
 �	�(	�
8	��9��:*��>~)
@~8
F~G
G~l
H~�
I~�
X~�Y~�\,
]T
^�	b��
d��
e�
f�
l�
t� 
u�H
v�pw�<
x�d
y�����
��
��
��H


�\

�`
�
��

��

��
��

�
�(
g�,
h�0
CPercona-Server-shared-575.7.3235.1.el8Percona Server - Shared librariesThis package contains the shared libraries (*.so*) which certain languages
and applications need to dynamically load and use Percona Server._���minimal-centos-8-x64-2265.ci.percona.com<}�Percona, IncCopyright (c) 2000, 2015, Oracle and/or its affiliates. All rights reserved. Under the GNU General Public License (http://www.gnu.org/licenses/).Percona MySQL Development Team <mysqldev@percona.com>Applications/Databaseshttp://www.percona.com/linuxx86_64,�5
+H;$8
a����A���A���A큤_��w_���_���_���_���_���_��h_���_���_��|598466b4954bc66c6f45f1f119211b0698d4a549f6c01b5d9a933a2511b8262663e5740d7dc7193cbe41c57e1336eb6af864dc5ce88e71abfeb217bcb770be36a57562ba5d2ca2b6533f878ef0cde009146116bb59c0424d642938846af0f2bcc75b0150ab31a25f15028c3665fde690594ce46b07d393582352cba97d4b5de5600090ca8703ac1531d1224f0afdaadb0eacb7ef98f4f2f9cacd45318d1bb080../../../../usr/lib64/mysql/libmysqlclient.so.20.3.19libmysqlclient.so.20.3.19rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootPercona-Server-57-5.7.32-35.1.el8.src.rpm������������������������������������Percona-Server-shared-57Percona-Server-shared-57(x86-64)libmysqlclient.so.20()(64bit)libmysqlclient.so.20(libmysqlclient_20.0)(64bit)libmysqlclient.so.20(libmysqlclient_20.3)(64bit)mysql-libsmysql-libs(x86-64)mysql-shared@@@@@@@@@@@@@@@@@@@@@@@







@/sbin/ldconfig/sbin/ldconfigPercona-Server-shared-compat-57libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libm.so.6()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)librt.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libssl.so.1.1(OPENSSL_1_1_1)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.2Y���W�@W��V�@V�w�V��@Vii@V
}@U��@U\w@Tи@T�@T�@S�S��S�.�S�@S���SX��SB�@S9X�S L@Sc@R��R�
@Rj]@Rj]@R^�REs@R6�R' �R��R��R@Rq@Q���Q�M�Q�Y@Q�Q�@Qֵ@Q��Q��Q��P��@Puc@Pn�P�@P@O��ON@N�@Np�@NoE�NoE�Nh�@N\�N\�NNP@NE�N-Z�N(�N��MR��MF�@L�LΫ�L�d�Lb��Lk@L�@K�@K���K�[�K��@K���K��@KuB�KK�K2@K
>�J�1@J��@J��J�u@J���J��x�������������������X�
78�?, PR������� �����hate �$L����������������
�h�h�h
�09a664bb065a2ff106a8734ecf8a678b8be19cddde6e96bcf9ba34dc44f2b9131a69f4afbe41fc66521a0ee291a7f11ec04dd5603b01a7c587ebda084dcd8c79f6a588064acadd29c1ea7f997ddd5768ba679ccd3e27de2d8dfe5a121c055ccbb6fd14e13fe9c03b4faee061042920e6f2ea6b6f03a85d259563237b7f81e79b67d07352fc11ac85e8d257f0cd094cd8b70ac9ab254b651c7be5c4748db81e295aa363731ee7ea41be7f05e0eea989db3349948643d6e46987c37a7d2947cbd92012eea53d4e8b205fe00dc33e3111f9e3837ff943d6e46987c37a7d2947cbd92012eea53d4e8b205fe00dc33e3111f9e3837ff9fb2b15aa8c4b7ad0272fde2e33490792898a4130b52592cdd99523a9484c78a198eb24e2e1f899add2ed18c693c9b8904310b2c48067123c0e3d59f046479310ceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f1508c32a3ac395af6321efd28be73d06a00f0db6ab887d1c21d4fec46128d2056d5a807787bb84b7a18c0cae00ae482f3c0a104021a64e933516ccaa60f57a2676ba5bfe7bd134d67c814d9094c62693521d6515803c70ff24ab07055e4081dcd26991db0dfb93890192221cdfa23b846197cd8ac92d1b0d67f8b81c0c6e435a7ebf1e5902164a0ae536d9e4430b6cb29884b718fc4df5901583f13a96d848266ad48c1a826039558e5fffb23605197a35250188300605244fa9ad8594b6731911ecdb4d37e32496110ccdb5bfc2ca0e84633a197e9623c87b0a95e59e947fbe44ead87517555c00e0f7dfd7181316bdc6b135d729a3da3babe51baa0d27fe2ee13801ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546b59621d09b1499d9f5f6686960cdff1d6f0c0fd1926f92735e622af3ed218285b48280d4a75309b6bca4888bfd09af9b941f76ced42cc503f9771675cddcf8ffb48280d4a75309b6bca4888bfd09af9b941f76ced42cc503f9771675cddcf8ffb19eb473e51b8b2551b745e075aec00752e9f5670e49a6ca4218d742682e2241119eb473e51b8b2551b745e075aec00752e9f5670e49a6ca4218d742682e224115753927405473df4a96765f1733d1111f0fe8c295459a0284f28cbcd6ebb6c33657cd25be9c8e8f8878554919b44d5f3372e446bf7dbc79d03f4af8f3bb058f1767b292b179354231de2103f671ab449a24c56899e69a5e84bcf24890ac7bc84767b292b179354231de2103f671ab449a24c56899e69a5e84bcf24890ac7bc84e85b538785e4488a95ef066d6f1866e96681cc4ab163c50060372f435964f07fe85b538785e4488a95ef066d6f1866e96681cc4ab163c50060372f435964f07fe5ba209f86c8c8a03b4b8112e3f8acd37c76abae8b65bf48465f4db391836d28e5ba209f86c8c8a03b4b8112e3f8acd37c76abae8b65bf48465f4db391836d2814041eb5e70ae4b6e917da5714d405d127835cec651b3b6d8347203479c6eb518dcb7e9e11ffa730b13383e58f6d1b9d34e6768df1d73eef9e0ed445294c8f83dacb0fd73d2eeb510d9e576bd440bfa6e93c07e080ef8888f70caa61d4a2d04cdacb0fd73d2eeb510d9e576bd440bfa6e93c07e080ef8888f70caa61d4a2d04c710ab7d0dd6a988263bd9c809cc42e278d6c1bed71497a4093c1f73bfff6e194710ab7d0dd6a988263bd9c809cc42e278d6c1bed71497a4093c1f73bfff6e1941639dd8b53d545c74f5d039336aec272636999c9a7373fe567b309f42696326915a6c10d9ed4b69442238a2e2d46943c6db79daac03792bc54e945abf925238dbd2d321f756801d39bc723dc10595d02e1d09c53c898da9b62be6d076ed5dd4dbd2d321f756801d39bc723dc10595d02e1d09c53c898da9b62be6d076ed5dd4d7ee0fedd8db0448d99fedb79bda7c910927887926e16c181bd5d6496695b640b7ee0fedd8db0448d99fedb79bda7c910927887926e16c181bd5d6496695b640bbd48a7bf6c9a40eeb267b5ed1247a138aa5789f2eb71bff55701adacbb076fa4bd48a7bf6c9a40eeb267b5ed1247a138aa5789f2eb71bff55701adacbb076fa490d30c490f2a4745950ad5ba79101d4a1b8e0246e6e02bf1785cbab3ccaa9f3590d30c490f2a4745950ad5ba79101d4a1b8e0246e6e02bf1785cbab3ccaa9f35ac956207026cd9e0e061fb43e6b9a88f214cd5b76999068cc4c294088afe82feac956207026cd9e0e061fb43e6b9a88f214cd5b76999068cc4c294088afe82fe1253d59df68df08f79060b2e6499597afa1b09f840b5d44784a87411c746f49d1253d59df68df08f79060b2e6499597afa1b09f840b5d44784a87411c746f49d4e9295cb1e72b77456ca11a62a61a9edc0a026218beb77290630ed54f17714c3d56ff05ed48038ef4b7ac1929142d590d182c7dccdd68e142c87be77f4fbf078e03037c767f06b12fa40ea02e4f14ecd475f327b9f8b193b2ca6e49f6829474ee03037c767f06b12fa40ea02e4f14ecd475f327b9f8b193b2ca6e49f6829474ee13a9bb4ec565f1b91262b1f86810648c56e48452e73e335e618f01c5b1263cbe13a9bb4ec565f1b91262b1f86810648c56e48452e73e335e618f01c5b1263cb90d10108b43b572b7e9d6ca9d98ed539191ef098823b236d28170737eb3dd94290d10108b43b572b7e9d6ca9d98ed539191ef098823b236d28170737eb3dd9429470cafda8457d242796f502db408e1092cba8c98f65d12d5b57d513ff9341129470cafda8457d242796f502db408e1092cba8c98f65d12d5b57d513ff9�x�������������p�����X�
  
?    �z�����������אrans�$G����������������
א֐ؐ
�cy
  problems with "libtool" causing the build to fail.
  (Change was done on Nov 11, but left uncommented.)- Extend the file existence check for "init.d/mysql" on un-install
  to also guard the call to "insserv"/"chkconfig".- added more man pages- Made yaSSL support an option (off by default)- Enabled yaSSL support- Give mode arguments the same way in all places
lenz@mysql.com>

- fixed the removing of the RPM_BUILD_ROOT in the %clean section (the
  $RBR variable did not get expanded, thus leaving old build roots behind)- Fixed the creation of the mysql user group account in the postinstall
  section (BUG 12348)
- Fixed enabling the Archive storage engine in the Max binary- Fixed the Requires: tag for the server RPM (BUG 12233)- create a "mysql" user group and assign the mysql user account to that group
  in the server postinstall section. (BUG 10984)- Do not build statically on i386 by default, only when adding either "--with
  static" or "--define '_with_static 1'" to the RPM build options. Static
  linking really only makes sense when linking against the specially patched
  glibc 2.2.5.- added mysql_client_test to the "bench" subpackage (BUG 10676)
- added the libndbclient static and shared libraries (BUG 10676)- use "mysqldatadir" variable instead of hard-coding the path multiple times
- use the "mysqld_user" variable on all occasions a user name is referenced
- removed (incomplete) Brazilian translations
- removed redundant release tags from the subpackage descriptions- Added a "make clean" between separate calls to "BuildMySQL".- Removed the mysql_tableinfo script made obsolete by the information schema- Enabled the "blackhole" storage engine for the Max RPM- removed the MySQL manual files (html/ps/texi) - they have been removed
  from the MySQL sources and are now available seperately.- old mysqlmanager, mysq* Mon Feb 7 2005 Tomas Ulin <tomas@mysql.com>

- enabled the "Ndbcluster" storage engine for the max binary
- added extra make install in ndb subdir after Max build to get ndb binaries
- added packages for ndbcluster storage engine- replaced obsoleted "BuildPrereq" with "BuildRequires" instead- enabled the "Federated" storage engine for the max binary- ISAM and merge storage engines were purged. As well as appropriate
  tools and manpages (isamchk and isamlog)- enabled the "Archive" storage engine for the max binary
- enabled the "CSV" storage engine for the max binary
- enabled the "Example" storage engine for the max binary- MySQL-Max now requires MySQL-server instead of MySQL (BUG 3860)- do not link statically on IA64/AMD64 as these systems do not have
  a patched glibc installed- Added libmygcc.a to the devel subpackage (required to link applications
  against the the embedded server libmysqld.a) (BUG 4921)- Added EXCEPTIONS-CLIENT to the "devel" package- disabled OpenSSL in the Max binaries again (the RPM packages were the
  only exception to this anyway) (BUG 1043)- fixed server postinstall (mysql_install_db was called with the wrong
  parameter)- added mysql_tzinfo_to_sql to the server subpackage
- run "make clean" instead of "make distclean"- added ncurses-devel to the build prerequisites (BUG 3377)- when using gcc, _always_ use CXX=gcc
- replaced Copyright with License field (Copyright is obsolete)- added myisam_ftdump to the Server package- link the mysql client against libreadline instead of libedit (BUG 2289)- marked /etc/logrotate.d/mysql as a config file (BUG 2156)- fixed file permissions (BUG 1672)- made testing for gcc3 a bit more robust- added missing file mysql_create_system_tables to the server subpackage- removed dependency on MySQL-client from the MySQL-devel subpackage
  as it is not really required. (BUG 1610)- Fixed BUG 1162 (removed macro names from the changelog)
- Really fixed BUG 998 (disable the checking for installed but
  unpackaged files)- Fixed BUG 959 (libmysqld not being compiled properly)
- Fixed BUG 998 (RPM build errors): added missing files to the
  distribution (mysql_fix_extensions, mysql_tableinfo, mysqld�x������������������X�
�?�ؤ�������:I�
�$Y����������������
I�H�J�
�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootPercona-Server-57-5.7.32-35.1.el8.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������MySQLMySQL-clientPercona-Server-client-57Percona-Server-client-57(x86-64)mysqlmysql-client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@







@Percona-Server-shared-57libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libm.so.6()(64bit)libncurses.so.6()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libreadline.so.7()(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libssl.so.1.1(OPENSSL_1_1_1)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.11)(64bit)libstdc++.so.6(GLIBCXX_3.4.15)(64bit)libstdc++.so.6(GLIBCXX_3.4.20)(64bit)libstdc++.so.6(GLIBCXX_3.4.21)(64bit)libstdc++.so.6(GLIBCXX_3.4.9)(64bit)libtinfo.so.6()(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-1Percona-SQL-client-50Percona-Server-client-51Percona-Server-client-55Percona-Server-client-564.14.2Y���W�@W��V�@V�w�V��@Vii@V
}@U��@U\w@Tи@T�@T�@S�S��S�.�S�@S���SX��SB�@S9X�S L@Sc@R��R�
@Rj]@Rj]@R^�REs@R6�R' �R��R��R@Rq@Q���Q�M�Q�Y@Q�Q�@Qֵ@Q��Q��Q��P��@Puc@Pn�P�@P@O��ON@N�@Np�@NoE�NoE�Nh�@N\�N\�NNP@NE�N-Z�N(�N��MR��MF�@L�LΫ�L�d�Lb��Lk@L�@K�@K���K�[�K��@K���K��@KuB�KK�K2@K
>�J�1@J��@J��J�u@J���J��@J�:�I-�I�@I�@H��H��@G��@G�@G�s@F8}@F��F
@E�{@E��E�=�E���E�<�En�E\R�EX^@D��Do�Da�DU�@DR�D<�D;�@D.k@D
u�D$@C��@C�t�C�.�C��@C�O@C�f@C�+�C�@C`�@CV5@CV5@CP�@B�@B�`@Bץ@B��B�:�B��@B�h�B�E@BfD@B]	�BQ,@A�@A�b�Aڅ@A�?@A-�A%�A��Ag@A�@�@@��@@qJ@@+j�@�@@�?��?�@?�\@?�s@?��@?O@@?/�@?�>��>���>l~@>H�>5@=2�@<�{�;��@:��@:Q�9�%@7�7�O�7{X@6�F�6@A�5��Evgeniy Patlan <evgeniy.patlan@percona.com>Evgeniy Patlan <evgeniy.patlan@percona.com> Evgeniy Patlan <evgeniy.patlan@percona.com>Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.11-4Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-3Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-2rc2Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-1rc1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.9-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Bjorn Munch <bjorn.munch@oracle.com> - 5.7.6-0.1.m16Erlend Dahl <erlend.dahl@oracle.com> - 5.7.5-0.6.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.5.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.4.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.3.m15Balasubramanian Kan�x�������������`�����X�
ab�?7487@������Ϟ6f68�$_����������������
ϞΞО
�ubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-1Joerg Bruehe <joerg.bruehe@oracle.com>Bjorn Munch <bjorn.munch@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Brajmohan Saxena <brajmohan.saxena@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Daniel Fischer <daniel.fischer@oracle.com>Tor Didriksen <tor.didriksen@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Daniel Fischer <daniel.fischer@oracle.com>Chuck Bell <chuck.bell@oracle.com>Sunanda Menon <sunanda.menon@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Georgi Kodinov <georgi.godinov@oracle.com>Georgi Kodinov <georgi.godinov@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@sun.com>Jonathan Perkin <jonathan.perkin@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Magnus Blaudd <mvensson@mysql.com>Alexander Nozdrin <alexander.nozdrin@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent.boortz@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Timothy Smith <tim@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Daniel Fischer <df@mysql.com>Daniel Fischer <df@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Jim Winstead <jimw@mysql.com>Jim Winstead <jimw@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Kristian Nielsen <knielsen@mysql.com>Kent Boortz <kent@mysql.com>Rodrigo Novo <rodrigo@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Lenz Grimmer <lenz@grimmer.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Joerg Bruehe <joerg@mysql.com>Guilhem Bichot <guilhem@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Petr Chardin <petr@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Petr Chardin <petr@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <�x��������������o����X�
um?Balhp������ڐom> �$J����������������
ڐِ

R
RRRRRR	RRRRRRRRRRR!R"RRRR
RRRR
R&R
RR	RRRRRRR"RRRR
RRRR
R&R
RRRRRRR	RRRRRRR"RRRR
RRRR
R&R
RRRRRRR	RRRRRRRRRRRR
R"RRRRR
R&R
RRRRRRRR	RRRRRRR"RRRR
RRRR
R&R
RRRRRRRR	RRRRRRR"RRRR
RRRR
R&R
RRRRRRR	RRRRRRRRR"RRRR
RRRR
R&R
RRRRR	RRR RRRRRRRRRRRR"RRRR
RRRR
R&R
RRRRRRR	RRRRRRR"RRRR
RRRR
R&R
RRRRRRR	RRRRRRRRR"RRRR
RRRR
R&utf-8b2138b82c406c5c0766e4e5f7fd77ce1f3942d18e545f73f42a1511da4876315?���t\�
_���
	�4�_�菱�b�v�[!�"��n�q�XN���.7-�g�Nj�*��BN{`��̑��~,sO�����p����G���@朗f�ҝ��%�m������<�R�r2�5̂��7�.[��2
3x׭�Kh��G"|�KѴ�<-t�>bǛ��,?�y�d(�ʍ
��j|�A T��U��Ch�?��#�5-���fǐT�E�j5N6�J��t	��[BM�Ry��2�6�%]^��<��<���	fIԖ��ge�� ��Dk#�p����?}1<�a+���}���R��Бd�d/I��_q���y=�%Cʱ��'`	�V� �S���V*�iX��#��$�ȷ�N
���d�<[Z��1we6���#j��C	�X��:��s�4/���Nϐ����ң�l���%�����E&UP�
�O�^�WuM"��5���9��Nnk�"�3�~ؒ���F���G�d�9C��|��Km<Sq
�:�ϋ@�zS��z�̪cRQ����z��~C��#��̾X�Q�B$��e��
_���
	�4�_�牢g�?��~|D'�ؘ����ޟ�_c{Z�1�q�C>����+J�u����7V=��h����}��T>`�x���{p�z(u�RB���b�:�Vͽ&\WK�5�3y|���v�������&��1Ǝ�a����a��ŤʂIԛ�?�
Ԭ�=���cs&3��)8�EY������8~fN��V���K"�sCc��qk�)����̌5N>�R��Yp
�����D����I��+oJ Kw��b����2�i��h�Ƥ�^��+�/ؿ6Ĩ2`���Y�mU���{ox���u
4콅+�w	T��/َ�N�{�� 0�DP% ���Q&�w�`���ș,�[O��f�$E�YR8��͝����~�BC���~��B]��f�T�dS a������x6���*F��������-^o^�L�:�z��oO��A�{w��l�%J�8�:�QH}p��(��{��S�q�ð69�Nm�b����Q��گ�D+a*nf��@�5224557912cfa1d2069e286eff9cfcb121191f1c9bda0a10d3ba2e4bc078ff9172d80efdc26ce6a4e607bffb275f2277b1e27771i�zVVf�i�zT11dd50a9d1f868ff0dcab2eecdc9f6b05597bd4728c8fc08279276784c656a041997a409e2ffa1621f89d876cae16a9ca5bba1908a8ec994e0daff533fe5cadb063de917665a27d4b2a29cea775e6f5a331e85fd46960e2c7cc27aedd9f12af087462ce8677ac81a2587ce2919427512704f7b21420a0dcebce13e57827a72941c6dddf324af0502c1e426477b3c634fa600090ca8703ac1531d1224f0afdaadb0eacb7ef98f4f2f9cacd45318d1bb080cc39fdfcc7a218ce7c6b4d56e9d5f7865a19db8062076b1405c32b2f9e1c5e79f8d31ff515bedd38e3da586e6cdc59d5ac7ca1045ebd706bb9f848d12ddb78844792978cb58ec98076dd961d680bd7c8e92159df184714a7efa98c009022e7f29acb8a5a51403ec00c7542d92d9300bff991f80221d14de6b576349ec9080e0234f7a2e26fe2e46ce1d71889fe92a251b10d06d1e473d1f5c943f53373ea0885573047a203197166bea5eb1b6f843cd47792d06ec7648921c7c956472db30eeb0db86de9754ffb63a0e0ee5886c9302b42d517cfb5bdd2dbf0c4ff294729f469edeb55b4f33c9c741af8827869d19a6b8ad7f10d69fef4b68e50070cc6ed20ba79da77fcf149cf0df47fadfe4a8aeb6ddfc619a44dcd6660327b5d186ea90da5efb01e162edfc079d0e7ad180844cf54201f1e3bcf7c494a38d3dfe99dd96f06../../../../usr/bin/mysql../../../../usr/bin/mysqlimport../../../../usr/bin/mysqlcheck../../../../usr/bin/mysqlshow../../../../usr/bin/mysql_config_editor../../../../usr/bin/mysqlbinlog../../../../usr/bin/mysqldump../../../../usr/bin/mysqlpump../../../../usr/bin/mysqladmin../../../../usr/bin/mysqlslap�x�������������P_����X�
�?t���������{����4
�$c����������������
�4�4�4
�ootrootrootrootrootrootrootrootrootrootrootmysqlmysqlmysqlmysqlrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlmysqlmysqlmysqlPercona-Server-57-5.7.32-35.1.el8.src.rpm�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������MySQL-server(x86-64)Percona-Server-server-57Percona-Server-server-57(x86-64)config(Percona-Server-server-57)mysql-servermysql-server(x86-64)@
 
�	@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@�x��������������N����X�
l.?ix t���������B�V so �$V����������������
�V�V�V
�
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d
e
f
g
h
i
j
k
l
m
n
oafazbgcacrhcsdadeeleneoesfifrfurglhrhuiditjakakokyltnbnlplptptrorurwskslsqsrsvtrukvizhzh2.28-1.el8



															








































































































































 !"#$%&'()*+,-./0123456789:;<=>?@ABCDExkbcompatREADMEaccessxbasiccapscompleteiso9995japanledcapslednumledscrolllevel5miscmousekeysolpcpcpc98xfree86xtestgeometryREADMEamigaatarittchiconydelldigital_vndrlkpcunixeverexfujitsuhhkhpkeytronickinesismacintoshmicrosoftnecnokianorthgatepcsanwasgi_vndrO2indigoindysonysteelseriessunteckthinkpadtypematrixwinbookkeycodesREADMEaliasesamigaatarittdigital_vndrlkpcemptyevdevfujitsuhpibmjollamacintosholpcsgi_vndrindigoindyirissonysunxfree86xfree98rulesREADMEbasebase.extras.xmlbase.lstbase.xmlevdevevdev.extras.xmlevdev.lstevdev.xmlxfree98xkb.dtdxkb.itsxorgxorg.lstxorg.xmlsymbolsafalaltwinamaplaraatauazbabdbebgbrbraibtbwbycacapslockcdchcmcncomposectrlczdedigital_vndrlkpcusvtdkdzeeemptyepoeseteueurosignfifofrfujitsu_vndrjpusgbgeghgngrgrouphp_vndrushrhuidieilininetiqirisitjolla_vndrsbjjpkekeypadkgkhkpdlkrkzlalatamlatinlevel3level5lkltlvmamacintosh_vndrapplechdedkfifrgbisitjplatamnlnoptseusmaomdmemkmlmmmnmtmvmynbspnec_vndrjpngnlnonokia_vndrrx-44rx-51su-8wnpolpcparenspcphpkplptrorsrurupeesignsesgi_vndrjpsharp_vndrsl-c3x00ws003shws007shws011shws020shshiftsisksnsony_vndrussrvr_ctrlsun_vndrarabebrcachczdedkeeesfifrgbgritjpkrltlvnlnoplptrorusesksolaristrtwuaussyterminatetgthtjtmtrtranstwtypotzuausuzvnxfree68_vndramigaatarittzatypesREADMEbasiccancelcapscompletedefaultextraiso9995level5mousekeysnokianumpadpcxkeyboard-configAUTHORSCOPYINGHOWTO.testingHOWTO.transitionNEWSREADMEREADME.configREADME.enhancingREADME.symbolsTODOxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.�x�������������@>����X�
prj? typh���������eaut�$~����������������
������
�9221b68200cf626020058875f025618df3412d515aca321934ceff60af55577e55996f338f6df9e3fabe83a1a415e3556c90f891775b0a09c5a1109dd594e2dd58739e39c0a200c6b7049a1e14b24312e08d72d6bf5ba14b97ba22d40a4a0e0427d565fc88585a46ad3d44a6db2a3d66bb6c3e3cc7fa1c018a66785../../../../usr/sbin/sedispatch
@@rootrootrootrootrootrootsetroubleshootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsetroubleshootsetroubleshootsetroubleshootrootrootrootrootrootrootsetroubleshootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsetroubleshootsetroubleshootsetroubleshootsetroubleshoot-3.3.26-6.el8.src.rpm���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������config(setroubleshoot-server)python3.6dist(setroubleshoot)python3dist(setroubleshoot)setroubleshoot-serversetroubleshoot-server(x86-64)
@@@@@@@@@@@









@/bin/sh/bin/sh/bin/sh/bin/sh/usr/libexec/platform-python/usr/sbin/groupadd/usr/sbin/useraddauditaudit-libs-python3config(setroubleshoot-server)dbusinitscriptslibauparse.so.0()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcap-ng.so.0()(64bit)libdbus-1.so.3()(64bit)libdbus-1.so.3(LIBDBUS_1_3)(64bit)libselinux-python3libselinux.so.1()(64bit)libxml2-python3policycoreutils-python-utilspolkitpython(abi)python3-dbuspython3-gobjectpython3-pydbusrpm-python3rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardl�x��������������-����X�
sa
?hat.@��'������(CIban�$8����������������
(C)C'C
�]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F
@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[
@E[
@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B�B	�@A�@A��A��A�_�A�_�A�_�AJ�AJ�AJ�A@E�A
@Ag@Remi Collet <remi@remirepo.net> - 7.3.33-11Remi Collet <remi@remirepo.net> - 7.3.33-10Remi Collet <remi@remirepo.net> - 7.3.33-9Remi Collet <remi@remirepo.net> - 7.3.33-8Remi Collet <remi@remirepo.net> - 7.3.33-7Remi Collet <remi@remirepo.net> - 7.3.33-6Remi Collet <remi@remirepo.net> - 7.3.33-5Remi Collet <remi@remirepo.net> - 7.3.33-3Remi Collet <remi@remirepo.net> - 7.3.33-2Remi Collet <remi@remirepo.net> - 7.3.33-1Remi Collet <remi@remirepo.net> - 7.3.32-1Remi Collet <remi@remirepo.net> - 7.3.31-2Remi Collet <remi@remirepo.net> - 7.3.31-1Remi Collet <remi@remirepo.net> - 7.3.30-1Remi Collet <remi@remirepo.net> - 7.3.29-1Remi Collet <remi@remirepo.net> - 7.3.28-2Remi Collet <remi@remirepo.net> - 7.3.28-1Remi Collet <remi@remirepo.net> - 7.3.27-2Remi Collet <remi@remirepo.net> - 7.3.27-1Remi Collet <remi@remirepo.net> - 7.3.26-2Remi Collet <remi@remirepo.net> - 7.3.26-1Remi Collet <remi@remirepo.net> - 7.3.26~RC1-1Remi Collet <remi@remirepo.net> - 7.3.25-1Remi Collet <remi@remirepo.net> - 7.3.25~RC1-1Remi Collet <remi@remirepo.net> - 7.3.24-1Remi Collet <remi@remirepo.net> - 7.3.24~RC1-2Remi Collet <remi@remirepo.net> - 7.3.24~RC1-1Remi Collet <remi@remirepo.net> - 7.3.23-1Remi Collet <remi@remirepo.net> - 7.3.23~RC1-1Remi Collet <remi@remirepo.net> - 7.3.22-1Remi Collet <remi@remirepo.net> - 7.3.22~RC1-1Remi Collet <remi@remirepo.net> - 7.3.21-1Remi Collet <remi@remirepo.net> - 7.3.21~RC1-1Remi Collet <remi@remirepo.net> - 7.3.20-1Remi Collet <remi@remirepo.net> - 7.3.20~RC1-2Remi Collet <remi@remirepo.net> - 7.3.20~RC1-1Remi Collet <remi@remirepo.net> - 7.3.19-1Remi Collet <remi@remirepo.net> - 7.3.19~RC1-1Remi Collet <remi@remirepo.net> - 7.3.18-1Remi Collet <remi@remirepo.net> - 7.3.18~RC1-1Remi Collet <remi@remirepo.net> - 7.3.17-1Remi Collet <remi@remirepo.net> - 7.3.17~RC1-1Remi Collet <remi@remirepo.net> - 7.3.16-1Remi Collet <remi@remirepo.net> - 7.3.16~RC1-1Remi Collet <remi@remirepo.net> - 7.3.15-1Remi Collet <remi@remirepo.net> - 7.3.15~RC1-1Remi Collet <remi@remirepo.net> - 7.3.14-1Remi Collet <remi@remirepo.net> - 7.3.14~RC1-1Remi Collet <remi@remirepo.net> - 7.3.13-1Remi Collet <remi@remirepo.net> - 7.3.13~RC1-1Remi Collet <remi@remirepo.net> - 7.3.12-1Remi Collet <remi@remirepo.net> - 7.3.12~RC1-1Remi Collet <remi@remirepo.net> - 7.3.11-1Remi Collet <remi@remirepo.net> - 7.3.11~RC1-1Remi Collet <remi@remirepo.net> - 7.3.10-1Remi Collet <remi@remirepo.net> - 7.3.10~RC1-2Remi Collet <remi@remirepo.net> - 7.3.10~RC1-1Remi Collet <remi@remirepo.net> - 7.3.9-1Remi Collet <remi@remirepo.net> - 7.3.9~RC1-1Remi Collet <remi@remirepo.net> - 7.3.8-1Remi Collet <remi@remirepo.net> - 7.3.8~RC1-1Remi Collet <remi@remirepo.net> - 7.3.7-3Remi Collet <remi@remirepo.net> - 7.3.7-2Remi Collet <remi@remirepo.net> - 7.3.7-1Remi Collet <remi@remirepo.net> - 7.3.7~RC3-1Remi Collet <remi@remirepo.net> - 7.3.7~RC2-1Remi Collet <remi@remirepo.net> - 7.3.7~RC1-2Remi Collet <remi@remirepo.net> - 7.3.7~RC1-1Remi Collet <remi@remirepo.net> - 7.3.6-2Remi Collet <remi@remirepo.net> - 7.3.6-1Remi Collet <remi@remirepo.net> - 7.3.6~RC1-2Remi Collet <remi@remirepo.net> - 7.3.6~RC1-1Remi Collet <remi@remirepo.net> - 7.3.5-2Remi Collet <remi@remirepo.net> - 7.3.5-1Remi Collet <remi@remirepo.net> - 7.3.5~RC1-1Remi Collet <remi@remirepo.net> - 7.3.4-3Remi Collet <remi@remirepo.net> - 7.3.4-2Remi Collet <remi@remirepo.net> - 7.3.4-1Remi Collet <remi@remirepo.net> - 7.3.4~RC1-2Remi Collet <remi@remirepo.net> - 7.3.4~RC1-1Remi Collet <remi@remirepo.net> - 7.3.3-1Remi Collet <remi@remirepo.net> - 7.3.3~RC1-2Remi Collet <remi@remirepo.net> - 7.3.3~RC1-1Remi Collet <re�x�������������0����X�
 4�?nstah��������$���5s (#�$����������������
55
�F�?$d
�
�
� 
�	'
�	X
��
��
��
��
�	�
��
�

�



(	
4

@
X�
���
,D��v(�
8�(9L(:1(F�
GH,IDXLYX\�]�^�b+
d{
e�
f�
l�
t�u�v�wHx`yxz���
��
��
��
��
� 


4

8

H

q
��

��
g�
h�
Clwdbadmin-python3-mysql1.0.222.el8MySQL libs and command line for Locaweb machinesMySQL libs and command line for Locaweb machinesg2?lwdbadminbuildOLocaweb LicenseApplications/Databaseshttps://code.locaweb.com.br/ct-banco/lwdbadmin-python3linuxx86_64
�L?
m;��������A�g29g29g29g29g29g2913673ab53f108d6b972203fd7449144b4575aca435564f670fd658b9137c82f48a823b9d0f877abeba5a3b764929a6ea439c8917dd40f73e3df147e84516e15ae33be64261304ebd406a7fee6607fb0312f087c21ed908683885b05c85556159ddd7e0d94a5beeb7de188cf9e91bdafff4190ef6c854bff1bb14ae71eb32288d4502fe4d5ab84cbd63c2b34914373d272fc5a21ccb35d0164dd86e97f3d1fda1rootrootrootrootrootrootrootlwprovisioningrootrootrootrootlwdbadmin-python3-1.0.2-22.el8.src.rpm������������������������config(lwdbadmin-python3-mysql)lwdbadmin-python3-mysqllwdbadmin-python3-mysql(x86-64)
 @







/bin/sh/usr/libexec/platform-pythonconfig(lwdbadmin-python3-mysql)lwdbadmin-python3rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1.0.2-22.el83.0.4-14.6.0-14.0-15.2-14.14.3g-�@f]�@f]�@f]�@f]�@f]�@f]�@fU�@fP�@fP�@fP�@fP�@fP�@fD��e���e���e���e�)�e�)�e�)�dgd�c�U@c�U@c��c�c�T@cױ@a��@]µ�]��@Y�J�X�Q@X��@X��@W�W�@V�I�V��V��Ug@Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-22Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-19Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-18Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-17Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-16Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-15Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-14Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-13Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-11Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-11Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-10Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-9Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-8Anderson Ramos <anderson.ramos@locaweb.com.br> - 1.0.2-7Fabiano Candiotto <fabiano.candiotto@locaweb.com.br> - 1.0.2-6Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-5Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-4Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-3Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-2Jairo Lenfers <jairo.lenfers@locaweb.com.br> - 1.0.2-1Jandy Lopes <jandy.lopes@locaweb.com.br> - 1.0.1Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-5Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-4Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-3Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-2Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.5-1Thiago Linhares <thiago.linhares@locaweb.com.br> - 4.4-1Jandy Lopes <jandy.lopes@locaweb.com.br> - 4.3Andre Ferraz <andre.ferraz@�x������������������X�
a@J?llec�����8&���Ǟemi �$W����������������
ǞƞȞ
�he runtime check for "libgcc.a", protect it against being tried
  with the Intel compiler "icc".- Change RPM file naming:
  - Suffix like "-m2", "-rc" becomes part of version as "_m2", "_rc".
  - Release counts from 1, not 0.- The "semisync" plugin file name has lost its introductory "lib",
  adapt the file lists for the subpackages.
  This is a part missing from the fix for bug#48351.
- Remove the "fix_privilege_tables" manual, it does not exist in 5.5
  (and likely, the whole script will go, too).- remove erroneous traces of the InnoDB plugin (that is 5.1 only).- Removed mysql_fix_privilege_tables- "mysqlmanager" got removed from version 5.4, all references deleted.- Merge up from 5.1 to 5.4: Remove handling for the InnoDB plugin.- This version does not contain the "Instance manager", "mysqlmanager":
  Remove it from the spec file so that packaging succeeds.- Add conditionals for bundled zlib and innodb plugin- Install plugin libraries in appropriate packages.
- Disable libdaemon_example and ftexample plugins.- Update variable used for mysql-test suite location to match source.- Correct yesterday's fix, so that it also works for the last flag,
  and fix a wrong quoting: un-quoted quote marks must not be escaped.- Removed "mysql_upgrade_shell"
- Removed some copy/paste between debug and normal build- Modify CFLAGS and CXXFLAGS such that a debug build is not optimized.
  This should cover both gcc and icc flags.  Fixes bug#40546.- Removed the "Federated" storage engine option, and enabled in all- Get rid of the "warning: Installed (but unpackaged) file(s) found:"
  Some generated files aren't needed in RPMs:
  - the "sql-bench/" subdirectory
  Some files were missing:
  - /usr/share/aclocal/mysql.m4  ("devel" subpackage)
  - Manual "mysqlbug" ("server" subpackage)
  - Program "innochecksum" and its manual ("server" subpackage)
  - Manual "mysql_find_rows" ("client" subpackage)
  - Script "mysql_upgrade_shell" ("client" subpackage)
  - Program "ndb_cpcd" and its manual ("ndb-extra" subpackage)
  - Manuals "ndb_mgm" + "ndb_restore" ("ndb-tools" subpackage)- Made the "Federated" storage engine an option
- Made the "Cluster" storage engine and sub packages an option- Add the man pages for "ndbd" and "ndb_mgmd".- Require a manual upgrade if the alread-installed mysql-server is
  from another vendor, or is of a different major version.- "ndb_size.tmpl" is not needed any more,
  "man1/mysql_install_db.1" lacked the trailing '*'.- Removed man page for "mysql_create_system_tables"- Add debug server.- Remove Max RPMs; the server RPMs contain a mysqld compiled with all
  features that previously only were built into Max.- Add several man pages for NDB which are now created.- Put back "libmygcc.a", found no real reason it was removed.

- Add CFLAGS to gcc call with --print-libgcc-file, to make sure the
  correct "libgcc.a" path is returned for the 32/64 bit architecture.- Fix the move of "mysqlmanager" to section 8: Directory name was wrong.- Include the new man pages for "my_print_defaults" and "mysql_tzinfo_to_sql"
  in the server RPM.
- The "mysqlmanager" man page got moved from section 1 to 8.- Call "make install" using "benchdir_root=%{_datadir}",
  because that is affecting the regression test suite as well.- Explicitly note that the "MySQL-shared" RPMs (as built by MySQL AB)
  replace "mysql-shared" (as distributed by SuSE) to allow easy upgrading
  (bug#22081).- Add "--with-partition" t 2006 Joerg Bruehe <joerg@mysql.com>

- Use the Perl script to run the tests, because it will automatically check
  whether the server is configured with SSL.- move "mysqldumpslow" from the client RPM to the server RPM (bug#20216)

- Revert all previous attempts to call "mysql_upgrade" during RPM upgrade,
  there are some more aspects which need to be solved before this is possible.
  For now, just ensure the binary "mysql_upgrade" is delivered and installysql.com>

- To run "mysql_upgrade", we need a running server;
  start it in isolation and skip password checks.- Always compile for P�x������������� �����X�
�_�?}]I=@Q�������{�������9S���$_����������������
�9�9
�Fa|?^8d
�
�
�
�	
�	1
�
D
�
H
�
`
�
d
�
�
�
�
�	
�
�
�
�
�
�
�

�\P\	\
�\0\�\
\x\D\
0\���(�
8�:9�::+�:G5�\H7<\I8�\X9Y9\9@\]:�\^?�bB 
dCp
eCu
fCx
lCz
tC�\uE\vFtwW�\xY0\yZ���]�
�]�
�]�
�]�
�^4


^H

^L
^\I

`�

`�
�a

a\ap
gat
hax
Cqdbm1.8.7842.el8.remiQuick Database ManagerQDBM is an embedded database library compatible with GDBM and NDBM.
It features hash database and B+ tree database and is developed referring
to GDBM for the purpose of the following three points: higher processing
speed, smaller size of a database file, and simpler API.aw�lbuilder.remirepo.net
!
Remi's RPM repository <https://rpms.remirepo.net/>LGPLv2+Remi ColletUnspecifiedhttp://fallabs.com/qdbm/linuxx86_64���rpq�A�rpa�A�Q�1����`a�A�A�1�r`��1�(Shg>b�k��
S�!�,��?��-�s
L/��
e�
������������������������A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�����A큤������������������������������������������������������aw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�jaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�kaw�baw�kaw�k;Q��LY��C�XLY�CC�$�>���aw�`aw�`LY�nLY��LY��LY��LY��LY��LY��LY��LY��LY��LY��LY��LY��LY��LY��LY��LY�~LY�{LY�yLY�wc054286cba041fe5a8cc281c0a280d0459f0642dd6271f5040bdb71d7f6ecac8c6f95fef8a85cb557bd94c5fadfc617f72cb73a1a4a2ab8da7d246659a20cb729635af2ac5188c8a9487e50c808967f4fa6e69642e5c698f6ef57a47ae08dd171ec22907765874e73af74b637440a1bf852db2708a42db46b6b45ebc00509f0a4054dc679a57c92dc345a77777700cfbbfbf55f8472ef612e437f7148cfb6eeacc70c6a22e359e628c1b23e0dd3d9ee03268b7fc6e6594833c107ca9f732073cd13729b16fa4301b397d4fc831ca8110ca36a437dd725ef928e4755dde2f36eb2a0a03c26283b2da05a2b37bbac8c313b9c735d23f8cb84ee4f2ab6d17aa99a967429e47fc95fdebed95e40653da0fc6ba2c87a40213ea13e30f054c3448a86c113977bcc2daf23fbd43d71a5722e23ed735415ec189234bb259990678cb5052591ac38040f578ad53a3bd81e73ed1f6ff3502063557a75d18866da0761bda1e78b328a779fca9717691db42b0830ba02ecd86210fc02b3055c6adb7084f0962bbe0ad150369f92e5a1d19239634f9444f3a103a566b2d3076847df84e5a727576ad55f6d52446dd357b5786abb65c1eada1f5bd6e61b3be97983db6a0c691256477632d7b6084a8afc6897a47b6b57d62a872763d4fb43c3194409bb129a0608fd0091bcf21810a4096c550c0fec65dfb3cf5aced0d75431785bcfe36952450bbe78b61117434e2ace5962bef93902ee55df78047a6796fdf7921a1b3306e53ce2190db02913a736986a21e64dcf40d7028a1b0a8b379745d3f269d711ac471b5ce6d51f87a42b404329538d820e119ed1229287bab280605167abb540f89fb96fdc7554bbdafefdb231df8966a46810a3955ee2bffa210ac60734193d3377aa190dc9c804375�x�������������������X�
TR�?LAGS��������PZ������)�te t�$9����������������
)�*�(�
�a331ac28480971baf2b83608bb73984c93d7d434ba0e57a8bd3a3e4b076a5f0348bafad8cb5272444378a946655bb6b9f32fd9a83b3c6450c02294277c463fe940c6dca5454e88ffd1fb69b73bb1c8e76825d9726e896a2c34265b72df5b0de76d73af0294263513b588aed90c51046aedc92f0c3819ef1c09c4d5c39e851d966b7f5bc74489b1e900149195cbca859e687c544c0a3e5c509bd96cf124884657f30ebf8d8a411c609b56cb687329c29db5774f59785d0182bf2b4274af753857430073fec2ab6994976663601c1457f4342f43c747fcd23fb6dde13f6dc060eb51546b0910724f95d9f690417a299e119f4a0b2ff3f1ff9688a73bcf7461725afb5b1014be09a5105fe9a730066b71aa13e23942ca198190dc000b37fb59e7644492da52b8bba6aefe8d95146b8029e2450719f9b4f057e4a77f0e77c3d7677b8ef20e803959554d91dc28c0f3de8e24da8055f49a10a6e5db5943a774d9f9203440fe64721e2f0d24840e9beac78a319392066c2b5c39a9d5f789ffa4d614871808823efbc429706c9bc7b2fcd06356228352e2fa807a87e019bf4e16532352c3eb7e718f0b3b9b458f93a7fa94f4f9a32685bc8c250e446feccb38fd9e5b9f3445129b5495afbc7309c297ebcc3fe4d8bd2e13b8a42c8e63d8d0bebd14aaf943d26f17db6030f20d4ac86da2f218246e00e14efde758895e38b0de567dd0425bc8659566546ccc53a675e37930c49aae6a19c635f01be07ae2c1afa4f24555e4e872d4c80509826f6b0286fb657da111f87b8ea2fb2653cebdbb180bccbec3a49d76a5c520f29d8c7386050ba5934c338fefae66b3b821e870ff6e779199d793a9984e2a12601c9ed9305f2d16ef147ef92c074f9dcf71592c8cb5fe434d2b7b86d2b00308f8353b1ac51d94df987db3ccf97100c40b48747ad008ead5632989648800ff50bf42cddd37658471626b2a7b4bb30ba635dfeab652a0dc582e95806863623609ab8a27a7d84d65555ff55b6c05322b39b02e2a7b7642896416c3628414899ec12ad97ef862283b8433533537de369f29cb90d982825183d743deb51b1d213dab95c433d29250fa563637bc52f90209335b6f5d510654f599d83bae0d3add1107b74c113fd561675fa259a2ff34a9168475064c5fe47c32908f92952c8ea6d66f3b4992dc0d43260edc96151547f03f0b1ec655dd40b81578c25b05541cb839f16e3be4ae48081423cd8276988d451d76c5af479d39fc5a401766e9a23dbcebf6c23553abb7df0dc58d020cfb5816f298494505b6f811945bff79b61b036d2e2394e3e573a153e14aa67e80bcbb4ecc0e456305038651f36559e1a2143d42e40f6b1f9bfc3aa2d67577f8b74c31ccf6dfbab47afb4b9cc373fdaacc0fdcfb19443659fc6a8d7d47fbc8e8401eabff249d4a50f1b83f3915f92e7ae7bef8252189523ee9086f63e7c503db0566b27f51a469a0b752b1ff14aa1ea305d1fb9da90601301295b633119ee4d3fd1cff295bc11cc7c6b880c6a71917ada0ae31982e33b9e80b55117941f95cb580e96a958da00f92ae6926f2b52cbac817448e733b23169c7cf4e1db898b71094768c035508894205eca016871d5e3aa88bc03ae2e0d2bbc4103ed66dcbe87d423030f65be1724e8cfe5b14024269d337c6df628d0eac3a27124f34484ddd11feb2014c0ea767962d6d65c3ba9dc2dec8437ae7cc9d560a7609dd5d54142ea2f64ba59caabd3560fe16bd0370b7d6a2cca672075d2bee4bf00b0087e7fddc69586d08c879d79db1fbd966bc79d6effef04f0e06e2d3d8e47fa4c85d04102def09787235db241219c41682a660cd6897adc8c2fcd7c493abfbe306665bbdfd75653fdaf3088dd7ac787bb9c8ccc1a2f072ac88c829f1607d65e436116ab40a8eb1e26de2c6625295cdecd0ad551a6d580b129eb1e6278766db1ff6bb4b93c1c7f5f5d214897bfa4c8979f777ae08ae45cc4060125a5c95c48aa89df738a50d4c227150b7fa0e4ebe87f267eed6d44126000e6e003008da4141599c5310aed832cabdb9c49999bf5a432d39e45d54f2be3e6b0ca397b7f29b5027f54feb23e147935aa8e7dafb55722e2c39fa470efb9d33abea69df987e047efcfe73b7507e5e26e32d436cc4ea9e243f14cc91349d4f092ef1253a65135dab4b94d4f47f3fc01e60bcd2bf2e79db2fb766e48b5861fc181bc5ef33392d9f8b8a72d203ee67ccffec511f479fc941c656100596b1689b9b1e0e4650793ae72e4c97f2de26aff59801ccdfc57b69f1e693850b3963b84c9978df32cd042ea0877ccd17abedbfc17f5e5da19cd418bd069592c40b7db0d5753dcc82a6a5ad8d8d30494ea945a4324276b4545f9b445fd3e55d31eb90828750d95c4a7d9397689261d9d1b6b6cecba95acadc63901aed2218decf4d7f90e5b00aba3884e73d98be95580712333efc94a6d6a5bdf6bd4d1ad578a3f624643e6f19587be9dae1cbff306595566a577cd108cdd8266e4c8288bd425dea58f13e5b2d154a24bfb39c0c3482e8fdec2c705ed4ebb9085d20f90c61d8de79d1b2ca9f4095a0fb3e52e0a4b2587db16417ee6ac058309bce35091384add6a8f108eeee78fb3b9c5b208318995740d18633ff6c0b1e45eec2aafa2c29492ed7531d2f01e1b0846f0a850577b0cd76d5b689745b70c9c72160c040556b0f9466706d84a149d9f921321715d4bddd93fcec68b9d816961abfd684b2101d8fbc7263f5314bfaac41a6d26e8e0829b7bb44720c78862a095410a12bcf5d751c3925eb52c590e81ca361aa7960cc6c08597e849591b073fcbf�x������������������X�
�	?
�cp����=5
�$-����������������
=5<5>5
�





























	


	






































































		




















	
	
	








	








































































	



































	













































































	

















	
	










	





















	











	

















	





	






















































	




























































	


�x�������������������X�
my�? not�������x�����herly�$K����������������
�h�h�h
�hvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhv6[x~[x~[x~[x~[x~[x~[x~[x~[x~[x~[x~[x~[x~[x~hv6[x~1add50599f540c71b5d2a4b6e159d2b190f73c69fc939295c0fe0f64177327bc1add50599f540c71b5d2a4b6e159d2b190f73c69fc939295c0fe0f64177327bc3030bdbede40c43b175f9a9c2a5073d939d6e93a6ebff0286e77e1089f57dcf30fa0c61472335671be0725258aa66ec3776407771c13acf98dd8432456a9d7663ce7cf2db932dbcb4e8d067bf2a6239996fe6301f9ea63faa526cd67cb3adc9b3ce7cf2db932dbcb4e8d067bf2a6239996fe6301f9ea63faa526cd67cb3adc9be8a010fd8dd25b4e40af622b5edd6137414d8450fe102c7f7f19a45417a67496e8a010fd8dd25b4e40af622b5edd6137414d8450fe102c7f7f19a45417a67496e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855c8e2c1d30fcec332241e137c058b7a2ef060645d6bf27acd9df03d49b39866ccc8e2c1d30fcec332241e137c058b7a2ef060645d6bf27acd9df03d49b39866cc5a22dc3d4aeea58daa378bbe78e99dddb57c591a86eb404d348f1fd7a7e89a165a22dc3d4aeea58daa378bbe78e99dddb57c591a86eb404d348f1fd7a7e89a16f15fe4bca2f1c1b9b94255f77fe0880aaf6c23ad108f90876c7a67e9f4e70978f15fe4bca2f1c1b9b94255f77fe0880aaf6c23ad108f90876c7a67e9f4e70978894cb54553f5f8612a791bf82dd40061f1c75c3155df31e157eb023f9845c761894cb54553f5f8612a791bf82dd40061f1c75c3155df31e157eb023f9845c761b6019a2f49b8268d957ae19fa0e3a27cbbfb6bba14109bb69f5bd192aa0fc3edce47023d337fe9370b5b436b960d35efaf91d5043f5953d39bcb33d51e3e1e33fef35a7394ebcf0b2bcdb38521b17ee5c1ea73f63668f4f60fbceb211d3a04ea4a801e0731905e3a33d898842c964fc66ee1d2909df14ad2c00592d034003aa54a801e0731905e3a33d898842c964fc66ee1d2909df14ad2c00592d034003aa52157719631f2c64e515bc2bf8df4b46826ec98487151ef1dc610362de31052b12157719631f2c64e515bc2bf8df4b46826ec98487151ef1dc610362de31052b1ee695e43c4303460352e4a3f1ff4a5796bd4a446fa2e8b74214e9c46ea2b3cbeee695e43c4303460352e4a3f1ff4a5796bd4a446fa2e8b74214e9c46ea2b3cbe52fe1cc85126d959f730df36c012d2d47f4a89d0b67554c73bf5ac75b7b0fc2c52fe1cc85126d959f730df36c012d2d47f4a89d0b67554c73bf5ac75b7b0fc2c320325c0f6451d1ceceb4c9c1a3f6bb59cb216aad6f2a4fbd980efeb9fd1760383c4e2d188a393ee7e74402b5c57d102fbf74a99e7c86157a6dae514c2eb73f5081930920b8f00065baaae38c5b445629824b2b277e879a28b0c6b995b140224081930920b8f00065baaae38c5b445629824b2b277e879a28b0c6b995b1402242243c6202a0f00dc3ef8b5a0fbee9d2a3003f165e33ce65ab07e9403fca231a32243c6202a0f00dc3ef8b5a0fbee9d2a3003f165e33ce65ab07e9403fca231a3fbd667d19ccb417d15b373e44744d99d090feceb5491431fb89be8e608443337fbd667d19ccb417d15b373e44744d99d090feceb5491431fb89be8e608443337fc133f5d7be8b791a3fada6083bf0bc8e36390b361312e2b3a19a5e68ed8ddfcfc133f5d7be8b791a3fada6083bf0bc8e36390b361312e2b3a19a5e68ed8ddfc562fc0d2b0107876d4f9af57d2db75c909bd46a92041b0d2c73470f16954f640448984089e1cff04e5693618c1960b1c489e6c331a00998ad683c0461c354f9ab8470106d1afcea96d82702ba9bf5ce11adc2275decc32e8b35e336c11e1589a4a290bd94ca76ec4f4aad63d96daa78277616bfb1fa34c3a5c6161021a12a1a44803117abcceddf2b6224159�x������������������X�
6(�	?bit)x"�����-5(64b�$=����������������
-5,5.5
�dbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwprovisioningrootrootlwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovi�x�������������x�����X�
5_�?_mes�������������� in �$����������������
������
�9f579db0a7caea436f523ab592294b4ce80826c4b05cdf5a33891882a1b96e007c0ac8dc9f99592f3667f79d83904a38e38e8bbe23eeea50fdd123a14d07b0df485cf390facfc1954b0ea82c8ae0d2c175393dff9d8b7ecd6463697591c771a71aaccdc3daac5c90325990fd491b2967396287895d75e4557580c0f681a5507ac7b3c0e64365f8ce6d5b37dc6221964631ac69c8a563af5e649fbe9eddc91461543dce1a2376c019afb2a8f78fc7e7d3e6e3b045305cdf5a33891882a1b96e007c0ac8dc9f99592f3667f79d83904a38e38e8bbe21c44b176a46cc16b4fbd200b42c6f9d93c054fec1ec9bb3750b3e44e0d464ef5cbc2f41b6550d1c933158caac917a3fb8b967c0a6cd10af534ad31c3b0a4f87c2f941a1b6e5b5172fddc4ac62a112cb3d7981dbcbcc5de3f706084210e35d2659a2898d1358e4faef974ceb3c515b214fb63e1e30c9fc75d18b4dec1e6fb13506fba5ee88300f8599c18bacb0b5bbf6518c16c03b536e8ee12b832fe7bc72686bb6d9916028dd5a14e6ef45d5724ceac4906b1ed5275b6d49e9460006435afbc05cdf5a33891882a1b96e007c0ac8dc9f99592f3667f79d83904a38e38e8bbe29c51e8863bee4699fff0bce77ff5aad420daee802b30d92633705f509a933502a83cde33912331f7d68cd1074997e95ce3c57c27185424cdb84d98d460a9e2dc7bc19422e1c5031a034042ea6e6b8d5ec81857ff9ee4605e505a40105227f90e1b745d2293bdfa5154ce1278236ac258f442caee7d328317c7e475880c261edb0666ee848e03a48f3ea7bb008dbe9d63dfde280af82fb4412a04bf4e24cab36b2e7459f43efe5301fbb8e62fc53f5868eaa783bdf837d6ebee07bb163aa0d916031c2509ab816bc1334ac5927e078b7bf2bf4080ca8e00633624c6f9f015c8d436bf9ae8f5a21a2fe884c069c300b91a40c3f862bffb107faf6abd27325c90efbc2d6664f6276fa0a72d57633b3ae68dc7dcb677b71018bf08c8e93e509f1357cf7266a829ac43fa3553b5a2f46fcde48bfc4d49385195cd660c3703ae17db67bd94492a709fdee2df44cfadee4c213a8cd7130f4db7dd9e1235065779862e35e31dd535a55ad3fb5775adc49776d17856186b0dc4af40009450b1c94414c840ce6269ab2ed1578adf7b9494f0b3d7157262ef3173f72b822dece1bac64436f9b58c016bca674fde528229277383da43b75abb4b3e41260a27f52258cd57e2c72b830c5434ad6e8a9ad32f9283b36ab3260db97919f7ec1f2b911df75f91e3bc1d922b77afa8742d29530d1d0cde58d18156931748ab8d4105700085b5e855261fa743ae0e0a59a0005d3494b9d34611bb1c56928f22e1920588cb7fe22ae3defc5ef00a4e76f5ef5ab6fd7f9b08162d2bc10f73babc9f1b252c4470b7febdf9cf23e48268e62185350c9334bf973740d006cd11b67c55cc701659684caf504fe3edc7e8b2832a9b5b2b8dcab3505b59a8ead95d0aa322bc935065dc61d1a3f7bf2840abde675fb5463645f48cc4049268385067fc69ef2cacdd9af700e5a99df2d52a28bd8aa9b04471ed8f60c3c2902bf2012aa56fbe03f71053bf0d36cdb10f0ba8505bffa82a0c85412d7bdcd96377d0caf56a4911f932db9374497bd6660215fe1b92ca0f0319eeccb5963deae963ac65a7f9fbe4ed4563e66ea77e9c5ae8280a7cd3fddd2e8e3d006415f9b92bcd6d930f12a84732c00ae3aa5fde611455d3558881d79f3e81ebf8e509ab39761301b43cb7dc1e79a30e0468471a210a4c32bd6e72fa45ac22b9484f94aa2ce60e62e4d7e34b964e200a41097704c9f10d3c1980ceb2e8b411f6072f679db4fc15eaf37b5594812f08ead149c2ab1e9afca8ac6f2886286375d392aebfe8fa44ec86997e35cfe40c4ee56553910a581ecedf0746166845e8281c2936403a44523708aab4dd6271ceb7265dce695dcd35389261f3e2a7f34f72523a27e8255b44846cffebb364c8823a3517ebe8d670f3084f29195670d83e7ff3342bcb56a3cd244ea1f0b2f2ed4bee4c931156bf6e871906e83f02ca4eb1251d7657d9b831341d9944535116de6e76ceb077b18cf5ba1f37e21e20fb43f6dbb767cc03e8fcd538cb28dc732963027a6ecbdd7a572a6e84d686fbd2e74fdd36d0995edcc98c4ab47102fb96f2b5dfb2ae5a7e6c91754013c35d6d2ac9c47ded22f2972bd3883aa495649002732ac219b69080a403cd1d2db87394437cf82d70c0f8cc64bfd5aea15a9526214cd6c5961ff1d07b44098d4516893749122aa218a4ccac96b9316007496eb8ae67b99257fb9ec59793a92627245c35523f6e00de3892e279d0fa3923f35c18634d5e3d4c118be30a541ae5de86051c11b10b8f02c1e10eda29e11197fe69885de0246a8fefbd3d388e5053abe7cbc46df78eec802c73a2ebc4418a29f071946f54a76b6ff0be3d1a6e1a61df0d11439afa88f8e69b313c92dbe6fe0ba9e481c356d8aed393009c39cb8dd3e8e64c00027af35675f274c498e8fa1c672a06c4db1c67114bd267c204a3f5e0f7c544841b4616baba8ea9c08c0eb4b1994e208a24fe3c36c3e87aad48596f3da503f1e262f4dde254a14a0991305f656c9ebabef91b28061ba01b39b84f73d4daeb611e9965bf1cb0c4e4f0d6c0a2c3c3519527f0f79f697561cd032cb6978fd37bcb96a2b12c94f24c3da1c9c27f19754a1c3e3c27de42c3ab054802e0db3edc322dbc773ca48d16ac45f6581b6ac619923025e29e931701ab1a8d26bb55739d9623236f65696d746ee5b35f302c321b04a9bb85623b043c384b481d63�x������������������X�
na�	?Vazq��������hP������net+�$����������������
a	�
�?
�����y��{эh^

:���x�������������h�����X�
�?(9��������������h�$J����������������
�h�h
�J
l?
ld
�
�
�$
�	-
�	[
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�	
�"
�J
�P
X
+
+		Z
+
�
+\
+W
+
X4
+\�
+b�
+h�
h�
+mdm�m�nWn�
n�
n�
(n�
8n��9q��:���G�L
+H��
+IŤ
+X��Y��\�
+]˨
+^�"b�r
d�
e�
f�
l�
t�
+u�l
+v�
w��
+x�d
+y���

�

�
 
�
&
�
h



|


�

�6


�


�
�
0


4
+
`
g
d
h
h
Cplatform-python-setuptools39.2.09.el8_10Easily build and distribute Python 3 packagesSetuptools is a collection of enhancements to the Python distutils that allow
you to more easily build and distribute Python packages, especially ones that
have dependencies on other packages.

This package also contains the runtime components of setuptools, necessary to
execute the software that requires pkg_resources.py.hvIord1-prod-a64build009.svc.aws.rockylinux.org,�BRocky Linux 8RockyMITinfrastructure@rockylinux.orgApplications/Systemhttps://pypi.python.org/pypi/setuptoolslinuxnoarch

~
��
u�
u�ppqqHkHkKK_Z_ZWf�

�
���
�
�!�"d��MM
�
�))\� 8my
�-$��u�	�	)	)X6�4�n��i&
DKK��v�:�:�\\����rr����	<	<������}�}�ii����66ZZ=&=&��==LL

	%��qqKK_Z_Z�

�
���
�
�!�"a��MM
�
�))\� /�my
�-$��u��'R��	5	588����	D	D&�&�!0!0��%%����Q�Q�99	:	:������	�	�PP������##p�	zG	�}�3u%|n�
T�`�K�	�tz
t�7�#���FV���u�	�	1	1JW������*y��K7���	!,��b�
��	��
&Oy�_
m�|	�=�
��6������A큤A큤������A큤A큤����������������A큤��A큤����������������������������������������������������A큤A큤����A�A큤����������������������A큤��������������������������������������������������������������������������������������������������������������A큤A큤����������A큤��A큤��������������������������������������������������������A큤A큤��������������������������������������������������������������������������������������������������������������������������������������������������������������A큤A큤����������������������������������������������A큤�큤����������������������A큤�x��������������w����X�
33l? reb����������dEches�$t����������������
dE��cE
�> 3.3.4-1Fedora Release Engineering <releng@fedoraproject.org> - 3.3.3-2Petr Lautrbach <plautrba@redhat.com> 3.3.3-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.3.1-0.4Richard Hughes <rhughes@redhat.com> - 3.3.1-0.3Michal Srb <msrb@redhat.com> - 3.3.1-0.2Petr Lautrbach <plautrba@redhat.com> 3.3.1-0.1Petr Lautrbach <plautrba@redhat.com> 3.2.24-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.2.24-2Petr Lautrbach <plautrba@redhat.com> 3.2.24-1Petr Lautrbach <plautrba@redhat.com> 3.2.23-1Richard Hughes <rhughes@redhat.com> - 3.2.22-2Petr Lautrbach <plautrba@redhat.com> 3.2.22-1Petr Lautrbach <plautrba@redhat.com> 3.2.21-1Kevin Fenzi <kevin@scrye.com> - 3.2.20-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.2.20-2Dan Walsh <dwalsh@redhat.com> - 3.2.20-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.2.19-2Dan Walsh <dwalsh@redhat.com> - 3.2.19-1Miroslav Grepl <mgrepl@redhat.com> - 3.2.18-1.1Dan Walsh <dwalsh@redhat.com> - 3.2.18-1Dan Walsh <dwalsh@redhat.com> - 3.2.18-1Dan Walsh <dwalsh@redhat.com> - 3.2.17-1Dan Walsh <dwalsh@redhat.com> - 3.2.16-2Dan Walsh <dwalsh@redhat.com> - 3.2.16-1Dan Walsh <dwalsh@redhat.com> - 3.2.15-2Dan Walsh <dwalsh@redhat.com> - 3.2.15-1Dan Walsh <dwalsh@redhat.com> - 3.2.14-2Dan Walsh <dwalsh@redhat.com> - 3.2.14-1Dan Walsh <dwalsh@redhat.com> - 3.2.13-2Dan Walsh <dwalsh@redhat.com> - 3.2.13-1Dan Walsh <dwalsh@redhat.com> - 3.2.12-1Adam Williamson <awilliam@redhat.com> - 3.2.11-2Dan Walsh <dwalsh@redhat.com> - 3.2.11-1Dan Walsh <dwalsh@redhat.com> - 3.2.10-1Dan Walsh <dwalsh@redhat.com> - 3.2.9-1Dan Walsh <dwalsh@redhat.com> - 3.2.8-1Dan Walsh <dwalsh@redhat.com> - 3.2.7-1Dan Walsh <dwalsh@redhat.com> - 3.2.6-1Dan Walsh <dwalsh@redhat.com> - 3.2.5-1Dan Walsh <dwalsh@redhat.com> - 3.2.4-1Dan Walsh <dwalsh@redhat.com> - 3.2.3-2Dan Walsh <dwalsh@redhat.com> - 3.2.3-1Dan Walsh <dwalsh@redhat.com> - 3.2.2-1Dan Walsh <dwalsh@redhat.com> - 3.2.1-1Dan Walsh <dwalsh@redhat.com> - 3.1.21-2Dan Walsh <dwalsh@redhat.com> - 3.1.21-1Dan Walsh <dwalsh@redhat.com> - 3.1.20-1Dan Walsh <dwalsh@redhat.com> - 3.1.19-2Dan Walsh <dwalsh@redhat.com> - 3.1.19-1Dan Walsh <dwalsh@redhat.com> - 3.1.18-1Dan Walsh <dwalsh@redhat.com> - 3.1.17-2Dan Walsh <dwalsh@redhat.com> - 3.1.17-1Dan Walsh <dwalsh@redhat.com> - 3.1.16-1Dan Walsh <dwalsh@redhat.com> - 3.1.15-1Dan Walsh <dwalsh@redhat.com> - 3.1.14-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.1.12-4Dan Walsh <dwalsh@redhat.com> - 3.1.12-3Dan Walsh <dwalsh@redhat.com> - 3.1.12-1Dan Walsh <dwalsh@redhat.com> - 3.1.11-1Dan Walsh <dwalsh@redhat.com> - 3.1.9-1Dan Walsh <dwalsh@redhat.com> - 3.1.8-1Dan Walsh <dwalsh@redhat.com> - 3.1.7-1Dan Walsh <dwalsh@redhat.com> - 3.1.6-1Dan Walsh <dwalsh@redhat.com> - 3.1.5-1Dan Walsh <dwalsh@redhat.com> - 3.1.4-1Dan Walsh <dwalsh@redhat.com> - 3.1.3-1Dan Walsh <dwalsh@redhat.com> - 3.1.2-1Dan Walsh <dwalsh@redhat.com> - 3.1.1-1Dan Walsh <dwalsh@redhat.com> - 3.0.47-1Dan Walsh <dwalsh@redhat.com> - 3.0.45-1Rex Dieter <rdieter@fedoraproject.org> 3.0.45-2<dwalsh@redhat.com> - 3.0.44-1<dwalsh@redhat.com> - 3.0.43-1<dwalsh@redhat.com> - 3.0.42-1<dwalsh@redhat.com> - 3.0.41-1<dwalsh@redhat.com> - 3.0.40-1<dwalsh@redhat.com> - 3.0.38-3<dwalsh@redhat.com> - 3.0.38-2<dwalsh@redhat.com> - 3.0.38-1<dwalsh@redhat.com> - 3.0.37-1<dwalsh@redhat.com> - 3.0.35-1<dwalsh@redhat.com> - 3.0.33-1<dwalsh@redhat.com> - 3.0.31-1<dwalsh@redhat.com> - 3.0.30-1<dwalsh@redhat.com> - 3.0.29-1<dwalsh@redhat.com> - 3.0.28-1<dwalsh@redhat.com> - 3.0.27-1<dwalsh@redhat.com> - 3.0.26-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.0.25-2<dwalsh@redhat.com> - 3.0.25-1<dwalsh@redhat.com> - 3.0.24-1<dwalsh@redhat.com> - 3.0.23-1<dwalsh@redhat.com> - 3.0.22-1<dwalsh@redhat.com> - 3.0.20-1<dwalsh@redhat.com> - 3.0.19-1<dwalsh@redhat.com> - 3.0.17-1<dwalsh@redhat.com> - 3.0.16-1<dwalsh@redhat.com> - 3.0.15-1<dwalsh@redhat.com> - 3.0.14-1<dwalsh@re�x�������������Xg����X�
b�?09e8���������i������X4423e�$H����������������
X4Y4
�EA�?<�d
�
�
�
�	!
�	@
��
��
��
��
��
��
�

�	

�
 
�
A
�
G

P

T
	
V


X

\

�


�

�

�

�

�

��(�
8�x9�x:�xG:D
H:H
I:L
X:PY:X\:p
]:t
^:�
b:�
d;�
e;�
f;�
l;�
t<
u<
v<
�<
�< 
�<H
�<N
�<�


<�

<�6
>�
>�6

A$

AM
�A�

A�
A�
gA�
hA�
Cfail2ban-firewalld1.0.23.el8Firewalld support for Fail2BanThis package enables support for manipulating firewalld rules.  This is the
default firewall service in Fedora.d(Bsbuildvm-s390x-25.s390.fedoraproject.org
?Fedora ProjectFedora ProjectGPLv2+Fedora ProjectUnspecifiedhttp://fail2ban.sourceforge.net/linuxnoarch
?��d(BWacbfb081cf9d0a4eac93371d3c0488dbdfcf8741ffdbded1d390b8f0e84bda1brootrootfail2ban-1.0.2-3.el8.src.rpm����config(fail2ban-firewalld)fail2ban-firewalld







config(fail2ban-firewalld)fail2ban-serverfirewalldrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1.0.2-3.el81.0.2-3.el83.0.4-14.6.0-14.0-15.2-14.14.3d%y�c�0�c��@cb[�c9}@b�?�b��b��a��a�N�aP`�`�@`�
@`���`��`>(�`@_��@_���_H�_ @_��_��^��^�H�^s^�^V]�^0"@^&�^�@^�@]�|@]��]��]Z�@]9��\R�@[�T@[�R@[H�@[(�@[(�@[(�@Z���Zz�@ZG�ZG�Z
�Y�X@Y�3�Yx�@Yg`�Yf@X�B�X��@Xt�Xo��XW�W��@W�H@W�H@W�H@W�@W�@W��V��@V�@V�@V�@V�I�V��U��U�a@UB@U�T��Txc�TO�@S�@S�S��S���S*�@S*�@S)��S(5@S&�RA~�R�R�@Q��Q�b�QC
@Q�P�9@P�	@Pv��P��O�M�J@Kw�J�;�J�^@J�u@I��@I3�H�M@H4�G�@G��G�h�G��@F��Fzh@Fb�@FT,�FN�E�T�E�@E��@Orion Poplawski <orion@nwra.com> - 1.0.2-3Fedora Release Engineering <releng@fedoraproject.org> - 1.0.2-2Richard Shaw <hobbes1069@gmail.com> - 1.0.2-1Richard Shaw <hobbes1069@gmail.com> - 1.0.1-2Richard Shaw <hobbes1069@gmail.com> - 1.0.1-1Fedora Release Engineering <releng@fedoraproject.org> - 0.11.2-14Python Maint <python-maint@redhat.com> - 0.11.2-13Orion Poplawski <orion@nwra.com> - 0.11.2-12Orion Poplawski <orion@nwra.com> - 0.11.2-11Fedora Release Engineering <releng@fedoraproject.org> - 0.11.2-10Mikel Olasagasti Uranga <mikel@olasagasti.info> - 0.11.2-9Fedora Release Engineering <releng@fedoraproject.org> - 0.11.2-8Python Maint <python-maint@redhat.com> - 0.11.2-7Richard Shaw <hobbes1069@gmail.com> - 0.11.2-6Python Maint <python-maint@redhat.com> - 0.11.2-5Zbigniew Jędrzejewski-Szmek <zbyszek@in.waw.pl> - 0.11.2-4Fedora Release Engineering <releng@fedoraproject.org> - 0.11.2-3Richard Shaw <hobbes1069@gmail.com> - 0.11.2-2Richard Shaw <hobbes1069@gmail.com> - 0.11.2-1Richard Shaw <hobbes1069@gmail.com> - 0.11.1-10.2Richard Shaw <hobbes1069@gmail.com> - 0.11.1-9.2Richard Shaw <hobbes1069@gmail.com> - 0.11.1-9Fedora Release Engineering <releng@fedoraproject.org> - 0.11.1-8Miro Hrončok <mhroncok@redhat.com> - 0.11.1-7Richard Shaw <hobbes1069@gmail.com> - 0.11.1-6Richard Shaw <hobbes1069@gmail.com> - 0.11.1-5Orion Poplawski <orion@nwra.com> - 0.11.1-4Fedora Release Engineering <releng@fedoraproject.org> - 0.11.1-3Orion Poplawski <orion@nwra.com> - 0.11.1-2Orion Poplawski <orion@nwra.com> - 0.11.1-1Orion Poplawski <orion@nwra.com> - 0.10.5-1Orion Poplawski <orion@nwra.com> - 0.10.4-8Orion Poplawski <orion@nwra.com> - 0.10.4-7Miro Hrončok <mhroncok@redhat.com> -�x��������������V����X�
dh�?om> p�������Xb������^�inz �$N����������������
^�_�]�
�8Orion Poplawski <orion@cora.nwra.com> - 2.7.10-7Thomas Spura <tomspur@fedoraproject.org> - 2.7.10-6Thomas Spura <tomspur@fedoraproject.org> - 2.7.10-5Thomas Spura <tomspur@fedoraproject.org> - 2.7.10-4Thomas Spura <tomspur@fedoraproject.org> - 2.7.10-3Matej Stuchlik <mstuchli@redhat.com> - 2.7.10-2Matej Stuchlik <mstuchli@redhat.com> - 2.7.10-1Peter Robinson <pbrobinson@fedoraproject.org> 2.7.9-11Robert Kuska <rkuska@redhat.com> - 2.7.9-10Matej Stuchlik <mstuchli@redhat.com> - 2.7.9-9Till Maas <opensource@till.name> - 2.7.9-8Till Maas <opensource@till.name> - 2.7.9-7Ville Skyttä <ville.skytta@iki.fi> - 2.7.9-6Karsten Hopp <karsten@redhat.com> 2.7.9-5Slavek Kabrda <bkabrda@redhat.com> - 2.7.9-4Slavek Kabrda <bkabrda@redhat.com> - 2.7.9-3Dan Horák <dan[at]danny.cz> - 2.7.9-2Matej Stuchlik <mstuchli@redhat.com> - 2.7.9-1Matej Stuchlik <mstuchli@redhat.com> - 2.7.8-10Matej Stuchlik <mstuchli@redhat.com> - 2.7.8-9Slavek Kabrda <bkabrda@redhat.com> - 2.7.8-8Slavek Kabrda <bkabrda@redhat.com> - 2.7.8-7Robert Kuska <rkuska@redhat.com> - 2.7.8-6Robert Kuska <rkuska@redhat.com> - 2.7.8-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.7.8-4Tom Callaway <spot@fedoraproject.org> - 2.7.8-3Robert Kuska <rkuska@redhat.com> - 2.7.8-2Robert Kuska <rkuska@redhat.com> - 2.7.8-1Dan Horák <dan[at]danny.cz> - 2.7.7-3Peter Robinson <pbrobinson@fedoraproject.org> 2.7.7-2Matej Stuchlik <mstuchli@redhat.com> - 2.7.7-1Dan Horák <dan[at]danny.cz> - 2.7.6-9Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.6-8Tomas Radej <tradej@redhat.com> - 2.7.6-7Tomas Radej <tradej@redhat.com> - 2.7.6-6Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.6-5Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.6-4Tomas Radej <tradej@redhat.com> - 2.7.6-3Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.6-2Tomas Radej <tradej@redhat.com> - 2.7.6-1Matej Stuchlik <mstuchli@redhat.com> - 2.7.5-11Dennis Gilmore <dennis@ausil.us> - 2.7.5-10Tomas Radej <tradej@redhat.com> - 2.7.5-9Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.5-8Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.5-7Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.5-6Matej Stuchlik <mstuchli@redhat.com> - 2.7.5-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.7.5-4Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.5-3Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.5-2Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.5-1David Malcolm <dmalcolm@redhat.com> - 2.7.4-5Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.4-4Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.4-3Kalev Lember <kalevlember@gmail.com> - 2.7.4-2Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.4-1David Malcolm <dmalcolm@redhat.com> - 2.7.3-35David Malcolm <dmalcolm@redhat.com> - 2.7.3-34David Malcolm <dmalcolm@redhat.com> - 2.7.3-33David Malcolm <dmalcolm@redhat.com> - 2.7.3-32David Malcolm <dmalcolm@redhat.com> - 2.7.3-31David Malcolm <dmalcolm@redhat.com> - 2.7.3-30David Malcolm <dmalcolm@redhat.com> - 2.7.3-29David Malcolm <dmalcolm@redhat.com> - 2.7.3-28David Malcolm <dmalcolm@redhat.com> - 2.7.3-27David Malcolm <dmalcolm@redhat.com> - 2.7.3-26David Malcolm <dmalcolm@redhat.com> - 2.7.3-25David Malcolm <dmalcolm@redhat.com> - 2.7.3-24David Malcolm <dmalcolm@redhat.com> - 2.7.3-23David Malcolm <dmalcolm@redhat.com> - 2.7.3-22David Malcolm <dmalcolm@redhat.com> - 2.7.3-21David Malcolm <dmalcolm@redhat.com> - 2.7.3-20David Malcolm <dmalcolm@redhat.com> - 2.7.3-19David Malcolm <dmalcolm@redhat.com> - 2.7.3-18David Malcolm <dmalcolm@redhat.com> - 2.7.3-17Peter Robinson <pbrobinson@fedoraproject.org> 2.7.3-16David Malcolm <dmalcolm@redhat.com> - 2.7.3-15David Malcolm <dmalcolm@redhat.com> - 2.7.3-14David Malcolm <dmalcolm@redhat.com> - 2.7.3-13Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.7.3-12Bohuslav Kabrda <bkabrda@redhat.com> - 2.7.3-11David Malcolm <dmalcolm@redhat.com> - 2.7.3-10David Malcolm <dmalcolm@redhat.com> - 2.7.3-9David Malcolm <dmalcolm@redhat.com> - 2.7.3-8David Malcolm <dmalcolm@redhat.com> - 2.7.3-7David Malcolm <dmalcolm@redhat.com> - 2.7.�x�������������HF����X�
.0z?1.RC��������������KNfedo�$[����������������
KNLNJN
�ntation, but "plumbing" is working.
- fixes for the date/time dialog
- remove install of setroubleshoot.glade, we now only use
   setroubleshoot_browser.glade
- some fixed to DateTimeDialog- Add back in the status icon- change dbclear trigger to 0.35- add sorting on category column and seen column in browser,
   fix reference to my_draw() in print function.

- make browser window hidden by default so it does not flash
   when it's first realized, connect to the "realize" signal to
   initially position the vpane, add signal handlers to track
   when the browser is visible, the presentation of the status
   icon now checks if the browser is visible, the status icon is
   not presented if the browser is already displayed.- Standardize on the browser. remove alert window
    [John Dennis <jdennis@redhat.com>]
- remove all vestiges of popup alert, now browser is the only
   UI game in town
- restore the automatic updating of the browser window which had
   been a regression, the AlertClient class now emits signals which
   the GUI classes can connect to receive signals from the fault server,
   also fix the "mark seen" regression
- browser.py: restore mark_seen timeout- Spell check plugins
- fix dbus instantiation- Add avc_syslog to syslog translated avc message
- Fix submitbug button
    [John Dennis <jdennis@redhat.com>]
- fix signature inflation, all data attached to a signature is now
   encapsulated in a SEFaultSignatureInfo (siginfo) class. The GUI no
   longer reaches into a signature looking for information, it looks
   in the siginfo. The Plugin class now defines the method
   get_signature() which report() calls to obtain the signature. The
   default signature provided by the Plugin class includes the
   analysisID, an AVC with just the src & target contexts, and the
   object_path. All data accesses and parameters which had been "sig
   and solution" are now done via the unified siginfo class. There is
   still a bit more work to be done on this but this represents a
   reasonble point to checkpoint the code in CVS.- Fix desktop- fix bug 203479, missing requires of audit-libs-python
- add support to sealert to listen on a dbus session signal to display
   the gui. This is needed for when the status icon is not visible and
   the user wants to see the UI. There is now a seperate program
   setroubleshoot_launch_gui which emits the signal.- Add Requires: audit-libs-python
- Add translations- Fix allow_execmem.py file
- Add translations- load_plugins() now catches exceptions when a plugin won't load,
   reports the traceback in the log file, and continues with the next
   plugin. Previously a bad plugin caused the entire plugin loading
   to abort and no plugins were loaded.
- Add "daemon_name" to automake variables, change pid file to match
- turn off "noreplace" on config file till things settle down a bit
- browser.py now validates data, also test for missing column data in the
   cell_data function to avoid exceptions.
- add stub for analyzie_logfile() rpc call
- turn off balloon notifications by default in config file,
   libnotify is just plain busted at this point :-(
- only the setroubleshootd daemon creates it's log file
   under /var/log now, the user app's do it in /tmp, change file
   permissions on /var/log/setroubleshoot back to 0644.
- sealert now looks up the username rather than hardcoding it to "foo"
- CamelCase to lowercase_underscore clean up- Zero out datbase.xml for updated browser- Fix 64 bit issue that caused runaway problem- add missing runcmd- fix for bug 202206, require correct version of audit,
   fixes for audit connection.- add html support
- remove setroubleshoot_dispatcher2006-08-08  Dan Walsh <dwalsh@redhat.com>
- Fix up handling of mls ranges in context
- Cleanup some pychecker errors

2006-08-07  John Dennis <jdennis@redhat.com>
- add first seen, last seen, and report count to alert detail view
- make the seen icon work, if the alert has been displayed more
   than N seconds, mark the alert as having been seen by the user
   and update the�x��������������5����X�
�?\���������J���Ҟ
�$B����������������
ҞўӞ
�t variables "MYSQL_BUILD_CC(CXX)" precedence
  over "CC" ("CXX").
- Drop the old "with_static" argument analysis, this is not supported
  in 5.1 since ages.
- Introduce variables to control the handlers individually, as well
  as other options.
- Use the new "--with-plugin" notation for the table handlers.
- Drop handling "/etc/rc.d/init.d/mysql", the switch to "/etc/init.d/mysql"
  was done back in 2002 already.
- Make "--with-zlib-dir=bundled" the default, add an option to disable it.
- Add missing manual pages to the file list.
- Improve the runtime check for "libgcc.a", protect it against being tried
  with the Intel compiler "icc".- Change RPM file naming:
  - Suffix like "-m2", "-rc" becomes part of version as "_m2", "_rc".
  - Release counts from 1, not 0.- The "semisync" plugin file name has lost its introductory "lib",
  adapt the file lists for the subpackages.
  This is a part missing from the fix for bug#48351.
- Remove the "fix_privilege_tables" manual, it does not exist in 5.5
  (and likely, the whole script will go, too).- remove erroneous traces of the InnoDB plugin (that is 5.1 only).- Removed mysql_fix_privilege_tables- "mysqlmanager" got removed from version 5.4, all references deleted.- Merge up from 5.1 to 5.4: Remove handling for the InnoDB plugin.- This version does not contain the "Instance manager", "mysqlmanager":
  Remove it from the spec file so that packaging succeeds.- Add conditionals for bundled zlib and innodb plugin- Install plugin libraries in appropriate packages.
- Disable libdaemon_example and ftexample plugins.- Update variable used for mysql-test suite location to match source.- Correct yesterday's fix, so that it also works for the last flag,
  and fix a wrong quoting: un-quoted quote marks must not be escaped.- Removed "mysql_upgrade_shell"
- Removed some copy/paste between debug and normal build- Modify CFLAGS and CXXFLAGS such that a debug build is not optimized.
  This should cover both gcc and icc flags.  Fixes bug#40546.- Removed the "Federated" storage engine option, and enabled in all- Get rid of the "warning: Installed (but unpackaged) file(s) found:"
  Some generated files aren't needed in RPMs:
  - the "sql-bench/" subdirectory
  Some files were missing:
  - /usr/share/aclocal/mysql.m4  ("devel" subpackage)
  - Manual "mysqlbug" ("server" subpackage)
  - Program "innochecksum" and its manual ("server" subpackage)
  - Manual "mysql_find_rows" ("client" subpackage)
  - Script "mysql_upgrade_shell" ("client" subpackage)
  - Program "ndb_cpcd" and its manual ("ndb-extra" subpackage)
  - Manuals "ndb_mgm" + "ndb_restore" ("ndb-tools" subpackage)- Made the "Federated" storage engine an option
- Made the "Cluster" storage engine and sub packages an option- Add the man pages for "ndbd" and "ndb_mgmd".- Require a manual upgrade if the alread-installed mysql-server is
  from another vendor, or is of a different major version.- "ndb_size.tmpl" is not needed any more,
  "man1/mysql_install_db.1" lacked the trailing '*'.- Removed man page for "mysql_create_system_tables"- Add debug server.- Remove Max RPMs; the server RPMs contain a mysqld compiled with all
  features that previously only were built into Max.- Add several man pages for NDB which are now created.- Put back "libmygcc.a", found no real reason it was removed.

- Add CFLAGS to gcc call with --print-libgcc-file, to make sure the
  correct "libgcc.a" path is returned for the 32/64 bit architecture.- Fix the move of "mysqlmanager" to section 8: Directory name was wrong.- Include the new man pages for "my_print_defaults" and "mysql_tzinfo_to_sql"
  in the server RPM.
- The "mysqlmanager" man page got moved from section 1 to 8.- Call "make install" using "benchdir_root=%{_datadir}",
  because that is affecting the regression test suite as well.- Explicitly note that the "MySQL-shared" RPMs (as built by MySQL AB)
  replace "mysql-shared" (as distributed by SuSE) to allow easy upgrading
  (bug#22081).- Add "--with-partition" t 2006 Joerg Bruehe <joerg@mysql.com>

- Use the �x�������������8%����X�
au]?est.�������������l�It's�$|����������������
l�k�m�
� for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php4



















�x������������������X�
k?<��������@(�������*

�$<����������������
�*
�*
�*

�ka@redhat.com> 7.19.6-3Kamil Dudka <kdudka@redhat.com> 7.19.6-2Kamil Dudka <kdudka@redhat.com> 7.19.6-1Ville Skyttä <ville.skytta@iki.fi> - 7.19.5-10Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.19.5-9Kamil Dudka <kdudka@redhat.com> 7.19.5-8Kamil Dudka <kdudka@redhat.com> 7.19.5-7Kamil Dudka <kdudka@redhat.com> 7.19.5-6Kamil Dudka <kdudka@redhat.com> 7.19.5-5Kamil Dudka <kdudka@redhat.com> 7.19.5-4Kamil Dudka <kdudka@redhat.com> 7.19.5-3Kamil Dudka <kdudka@redhat.com> 7.19.5-2Kamil Dudka <kdudka@redhat.com> 7.19.5-1Kamil Dudka <kdudka@redhat.com> 7.19.4-11Kamil Dudka <kdudka@redhat.com> 7.19.4-10Kamil Dudka <kdudka@redhat.com> 7.19.4-9Kamil Dudka <kdudka@redhat.com> 7.19.4-8Debarshi Ray <rishi@fedoraproject.org> 7.19.4-7Kamil Dudka <kdudka@redhat.com> 7.19.4-6Kamil Dudka <kdudka@redhat.com> 7.19.4-5Kamil Dudka <kdudka@redhat.com> 7.19.4-4Kamil Dudka <kdudka@redhat.com> 7.19.4-3Jindrich Novy <jnovy@redhat.com> 7.19.4-2Jindrich Novy <jnovy@redhat.com> 7.19.4-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.19.3-2Kamil Dudka <kdudka@redhat.com> 7.19.3-1Jindrich Novy <jnovy@redhat.com> 7.18.2-9Jindrich Novy <jnovy@redhat.com> 7.18.2-8Jindrich Novy <jnovy@redhat.com> 7.18.2-7Warren Togami <wtogami@redhat.com> 7.18.2-6Tom "spot" Callaway <tcallawa@redhat.com> 7.18.2-5Tom "spot" Callaway <tcallawa@redhat.com> 7.18.2-4Jindrich Novy <jnovy@redhat.com> 7.18.2-3Jindrich Novy <jnovy@redhat.com> 7.18.2-2Jindrich Novy <jnovy@redhat.com> 7.18.2-1Jindrich Novy <jnovy@redhat.com> 7.18.1-2Jindrich Novy <jnovy@redhat.com> 7.18.1-1Jindrich Novy <jnovy@redhat.com> 7.18.0-2Jindrich Novy <jnovy@redhat.com> 7.18.0-1Jindrich Novy <jnovy@redhat.com> 7.17.1-6Jindrich Novy <jnovy@redhat.com> 7.17.1-5Jindrich Novy <jnovy@redhat.com> 7.17.1-4Jindrich Novy <jnovy@redhat.com> 7.17.1-3Jindrich Novy <jnovy@redhat.com> 7.17.1-2Jindrich Novy <jnovy@redhat.com> 7.17.1-1Jindrich Novy <jnovy@redhat.com> 7.16.4-10Jindrich Novy <jnovy@redhat.com> 7.16.4-9Jindrich Novy <jnovy@redhat.com> 7.16.4-8Jindrich Novy <jnovy@redhat.com> 7.16.4-7Jindrich Novy <jnovy@redhat.com> 7.16.4-6Jindrich Novy <jnovy@redhat.com> 7.16.4-5Jindrich Novy <jnovy@redhat.com> 7.16.4-4Jindrich Novy <jnovy@redhat.com> 7.16.4-3Jindrich Novy <jnovy@redhat.com> 7.16.4-2Jindrich Novy <jnovy@redhat.com> 7.16.4-1Jindrich Novy <jnovy@redhat.com> 7.16.3-1Jindrich Novy <jnovy@redhat.com> 7.16.2-5Jindrich Novy <jnovy@redhat.com> 7.16.2-4Jindrich Novy <jnovy@redhat.com> 7.16.2-3Jindrich Novy <jnovy@redhat.com> 7.16.2-2Jindrich Novy <jnovy@redhat.com> 7.16.2-1Jindrich Novy <jnovy@redhat.com> 7.16.1-3Jindrich Novy <jnovy@redhat.com> 7.16.1-2Jindrich Novy <jnovy@redhat.com> 7.16.1-1Jindrich Novy <jnovy@redhat.com> 7.16.0-5Jindrich Novy <jnovy@redhat.com> 7.16.0-4Jindrich Novy <jnovy@redhat.com> -7.16.0-3Jindrich Novy <jnovy@redhat.com> - 7.16.0-2Jindrich Novy <jnovy@redhat.com> - 7.16.0-1Jindrich Novy <jnovy@redhat.com> - 7.15.5-1.fc6Ivana Varekova <varekova@redhat.com> - 7.15.4-1Ivana Varekova <varekova@redhat.com> - 7.15.3-1Ivana Varekova <varekova@redhat.com> - 7.15.1-2Jesse Keating <jkeating@redhat.com> - 7.15.1-1.2.1Jesse Keating <jkeating@redhat.com> - 7.15.1-1.2Jesse Keating <jkeating@redhat.com>Ivana Varekova <varekova@redhat.com> 7.15.1-1Ivana Varekova <varekova@redhat.com> 7.15.0-3Ivana Varekova <varekova@redhat.com> 7.15.0-2Ivana Varekova <varekova@redhat.com> 7.15.0-1Ivana Varekova <varekova@redhat.com> 7.14.1-1Ivana Varekova <varekova@redhat.com> 7.14.0-1Ivana Varekova <varekova@redhat.com> 7.13.1-3Joe Orton <jorton@redhat.com> 7.13.1-2Ivana Varekova <varekova@redhat.com> 7.13.1-1Tomas Mraz <tmraz@redhat.com> 7.13.0-2Florian La Roche <laroche@redhat.com>Joe Orton <jorton@redhat.com> 7.12.3-3Adrian Havill <havill@redhat.com> 7.12.3-1Adrian Havill <havill@redhat.com> 7.12.1-1Adrian Havill <havill@redhat.com> 7.12.0-4Warren Togami <wtogami@redhat.com> 7.12.0-3Jindrich Novy <jnovy@redhat.com>Elliot Lee <sopwith@redhat.com>Adrian Havill <havil�x�������������(����X�
to�?.1
-���������5age
�$����������������
55
N
locaweb.com.br> - 4.2Andre Ferraz <andre.ferraz@locaweb.com.br> - 4.1Edi Carlos <edi.carlos@locaweb.com.br> 4.0Edi Carlos <edi.carlos@locaweb.com.br> 3.8-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 3.7-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 3.6-2Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 3.1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 3.0Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 1.0-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 0.8-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 0.5-1Jose Arthur Benetasso Villanova <jose.arthur@locaweb.com.br> 0.1-1- Fix routes to vpshost- Fix routes to /pgsql- Change to python 3.6 (uwsgi plugin is compatible with python3.6)- Change to python 3.9 (python3.11 caused some errors)- Fix errors- Fix requirements.txt- Fix postgres scripts and convert to python 3.11- Add lwdbadmin.key in auth function- Add PyMySQL in requirements.txt- Cange name of lwdbadmin-python3- Fix some errors- Refact mysql route- Fix package name and location- Changed scripts that was on python2 interpreter to python3 interpreter- New release- Fix virtualenv- Create virtualenv and build to /opt/lc/lwdbadmin- Change log dir to /var/log/lwdbadmin-python3- Fix building to python3- Change build.sh to python3- Convert app to python3- Fix osuser variable to interop between products- Fixed socket path- Minor improvements- Treat errors in proxysql bootstrap
- remove invalid password characters- Added proxysql bootstrap (random admin and monitor credentials, default port 3306)- Implemented new logic to MYSQL Multi-Tenancy
- Now tag description 'reseller' is avaiable to use.- Fixes on lwmyauth script- Fixes on lwmysrvadm- Include lwmyauth script
- Bootstrap adjustments for MySQL 5.7- Alter script to acept 5.6 and 5.7 mysql version
- Change hash root password- Reduce lvm size to 50G- Fix trocasenha- Restart uwsgi after install packages- lwmysrvadm to help G2 creation- Fixes to use in G2- Preparing to production- script to help creating a service- Use PATCH- Initial releaselwdbadminbuild 1731335487






1.0.2-22.el81.0.2-22.el81.0.2-22.el8
lwmyctrlmysql.cnflwmyauthlwmyctrllwmysrvadmmysql/etc/bash_completion.d//etc/locaweb/lwdbadmin//opt/lc/lwdbadmin/bin//usr/share/lwdbadmin/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu

ASCII textPython script, ASCII text executablePython script, ASCII text executable, with very long linesdirectory



R
R
R
g�1Ĩn�+�H6��Wsystemctl restart uwsgi

# Jairo Lenfers - 12-01-2024/bin/shutf-8b5155ded2300b3060be2ff8ff9a1d157a919da7c60ef534a27d79b4d192b4efe?���00��I���6L涄-8�\49c4ee6f2df76ad2f199679f42edd3602e9a9b4f8be105ccbeb3d6ce61692b01fac47552a81efb586bb18325881e57186299469186g�QR�g�Jm (Jarod Wilson) [1860496]
- [wireless] mt76: mt7615: initialize radar specs from host driver (Jarod Wilson) [1860496]
- [wireless] mt76: mt76x2: get rid of leftover target (Jarod Wilson) [1860496]
- [wireless] mt76: mt7615: add tracing support (Jarod Wilson) [1860496]
- [wireless] mt76: move mac_txdone tracepoint in mt76 module (Jarod Wilson) [1860496]
- [wireless] mt76: move dev_irq tracepoint in mt76 module (Jarod Wilson) [1860496]
- [wireless] mt76: mt7615: add a get_stats() callback (Jarod Wilson) [1860496]
- [wireless] mt76: mt7615: add per-phy mib statistics (Jarod Wilson) [1860496]
- [wireless] mt76: mt7615: report TSF information (Jarod Wilson) [1�x�������������������X�
72�?9a13�2ЕX�bf46�$H����������������
X�Y�W�
�ect that Python 2 is not the default Python- apply modularity patch only during module builds- add missing patch- drop a couple of dependencies for Modularity builds- Add --executable option to install.py command- Fix the upgrade path to F26 due to renaming the package to python2 (rhbz#1420332)- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuild for readline 7.x- Update to 2.7.13
- Don't blow up on EL7 kernel (random generator) (rhbz#1410175, rhbz#1410187)
- Require glibc >= 2.24.90-26 (rhbz#1410644)- Rename package to python2 and also rename the subpackages accordingly
- Provide and obsolete python and the respective subpackages to ensure a clean
upgrade path
- Remove old provides for packages that got into stdlib
- Implement PEP 394- Port ssl and hashlib modules to OpenSSL 1.1.0
- Drop hashlib patch for now
- Add riscv64 arch to 64bit and no-valgrind arches- Provide python27- Remove unversioned Obsoletes- Rebase rewheel patch so it applies properly (rhbz#1372183)- SPEC file cleanup
- Removal of unapplied patches- Fix for CVE-2016-1000110 HTTPoxy attack
- SPEC file cleanup- Build properly on MIPS- Update to 2.7.12
- Refactored patches: 10, 102, 112, 134, 153
- Dropped patches: 166, 209, 210- Refactor patch for properly fixing CVE-2016-5636- Fix test_pyexpat failure with Expat version of 2.2.0- Fix for: CVE-2016-0772 python: smtplib StartTLS stripping attack
- Raise an error when STARTTLS fails
- rhbz#1303647: https://bugzilla.redhat.com/show_bug.cgi?id=1303647
- rhbz#1346344: https://bugzilla.redhat.com/show_bug.cgi?id=1346344
- Fixed upstream: https://hg.python.org/cpython/rev/b3ce713fb9be- Added patch for fixing possible integer overflow and heap corruption in zipimporter.get_data()- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Drop macros, require python/python2-rpm-macros- Get ready for separate python-macros package- Update to 2.7.11- provide/obsolete _isa packages in python_provide (#1271776)- Revert the moving modules to python-tools because distutils uses lib2to3- Move idlelib and lib2to3 modules to pythont-tools- Fix quoting in %python_provide macro- Add obsoletes to %python_provide macro to fix upgrade path
- Fix python2- provides for python- packages in %python_provide- python-macros: remove R on python (#1246036)- Include epoch in the python_provide macro fpc#534 (Slavek Kabrda)- correct python_provide macro to include version only when emiting provides- Add unversioned python-macros from fpc#281 and fpc#534
  and require it from python-devel
- Make python-macros noarch- Make relocating Python by changing _prefix actually work
Resolves:             rhbz#1231801- Update to 2.7.10- Disable test_gdb on aarch64 (rhbz#1196181), it joins all other non x86 arches- Remove provides/obsolates for unittest2
- Skip test_gdb on arm until rhbz#1196181 is resolved- Add proper rewheel Requires- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- Own systemtap dirs (#710733)- disable test_gdb on ppc64* until rhbz#1132488 is really resolved- We need to provide both arch specific and noarch Provide for python2-devel
in order not to break noarch builds.- Make python2-devel provide arch specific.
Resolves:             rhbz#1183530- build with valgrind on ppc64le
- disable test_gdb on s390(x) until rhbz#1181034 is resolved- Update to 2.7.9
- Refreshed patches: #55, #137, #146, #153, #156, #198
- Dropped patches: #196, #197
- New patch: #199
- Added the rewheel module- Improve python2_version macros- Add python2_version_nodots macro- Revert previous change, see rhbz#1161166#c6.- Provide importable unittest2
Resolves:             rhbz#1161166- Update patch 196 (ssl backport)- Backport ssl module from python3- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- Enable SSLv2 and S�x������������������X�
<r�?fedo��������8 �������-2R�$v����������������
���
� <nalin@redhat.com> 1.9-9Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9-8Nalin Dahyabhai <nalin@redhat.com> 1.9-7Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9-6Nalin Dahyabhai <nalin@redhat.com> 1.9-5Nalin Dahyabhai <nalin@redhat.com> 1.9-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.9-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9-2Nalin Dahyabhai <nalin@redhat.com> 1.9-1Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta3.1Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta3.0Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta2.0Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta1.1Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta1.0Nalin Dahyabhai <nalin@redhat.com> 1.8.3-8Nalin Dahyabhai <nalin@redhat.com> 1.8.3-7Nalin Dahyabhai <nalin@redhat.com> 1.8.3-6jkeating - 1.8.3-5Nalin Dahyabhai <nalin@redhat.com> 1.8.3-4Nalin Dahyabhai <nalin@redhat.com> 1.8.3-3Nalin Dahyabhai <nalin@redhat.com> 1.8.3-2Nalin Dahyabhai <nalin@redhat.com> 1.8.3-1Nalin Dahyabhai <nalin@redhat.com> 1.8.2-3Nalin Dahyabhai <nalin@redhat.com> 1.8.2-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.8.2-1Nalin Dahyabhai <nalin@redhat.com> 1.8.1-7Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.8.1-6Nalin Dahyabhai <nalin@redhat.com> 1.8.1-5Nalin Dahyabhai <nalin@redhat.com> 1.8.1-4Nalin Dahyabhai <nalin@redhat.com> 1.8.1-3Nalin Dahyabhai <nalin@redhat.com> 1.8.1-2Nalin Dahyabhai <nalin@redhat.com> 1.8.1-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.8-5Nalin Dahyabhai <nalin@redhat.com> - 1.8-4Nalin Dahyabhai <nalin@redhat.com> - 1.8-3Nalin Dahyabhai <nalin@redhat.com> - 1.8-2Nalin Dahyabhai <nalin@redhat.com> - 1.8-1Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-6Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-5Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-4Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-3Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-2Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-1Nalin Dahyabhai <nalin@redhat.com> - 1.7-23Nalin Dahyabhai <nalin@redhat.com> - 1.7-22Nalin Dahyabhai <nalin@redhat.com> - 1.7-21Nalin Dahyabhai <nalin@redhat.com> - 1.7-20Nalin Dahyabhai <nalin@redhat.com> - 1.7-19Nalin Dahyabhai <nalin@redhat.com> - 1.7-18Nalin Dahyabhai <nalin@redhat.com> - 1.7-17Nalin Dahyabhai <nalin@redhat.com> - 1.7-16Dennis Gregorovic <dgregor@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-15Nalin Dahyabhai <nalin@redhat.com> - 1.7-14Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-13Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-12Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-11Nalin Dahyabhai <nalin@redhat.com> - 1.7-10Nalin Dahyabhai <nalin@redhat.com> - 1.7-9Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-7Tomas Mraz <tmraz@redhat.com> - 1.7-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.7-5Nalin Dahyabhai <nalin@redhat.com> 1.7-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.7-4Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.7-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.7-2Nalin Dahyabhai <nalin@redhat.com> 1.7-1Nalin Dahyabhai <nalin@redhat.com> 1.6.3-106Nalin Dahyabhai <nalin@redhat.com> 1.6.3-105Nalin Dahyabhai <nalin@redhat.com> 1.6.3-104Nalin Dahyabhai <nalin@redhat.com> 1.6.3-103Nalin Dahyabhai <nalin@redhat.com> 1.6.3-102Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.3-101Nalin Dahyabhai <nalin@redhat.com> 1.6.3-100Nalin Dahyabhai <nalin@redhat.com> 1.6.3-19Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.6.3-18Nalin Dahyabhai �x�������������������X�
m>�?1.2-�������RՐalin�$E����������������
ՐL�֐
�ded example external authentication (WL#1054) plugin binaries- With a recent spec file cleanup, names have changed: A "-community" part was dropped.
  Reflect that in the "Obsoletes" specifications.
- Add a "triggerpostun" to handle the uninstall of the "-community" server RPM.
- This fixes bug#55015 "MySQL server is not restarted properly after RPM upgrade".- Change the behaviour on installation and upgrade:
  On installation, do not autostart the server.
  *Iff* the server was stopped before the upgrade is started, this is taken as a
  sign the administrator is handling that manually, and so the new server will
  not be started automatically at the end of the upgrade.
  The start/stop scripts will still be installed, so the server will be started
  on the next machine boot.
  This is the 5.5 version of fixing bug#27072 (RPM autostarting the server).- Implement SELinux checks from distribution-specific spec file.- Large number of changes to build using CMake
- Introduce distribution-specific RPMs
- Drop debuginfo, build all binaries with debug/symbols
- Remove __os_install_post, use native macro
- Remove _unpackaged_files_terminate_build, make it an error to have
  unpackaged files
- Remove cluster RPMs- Add "--with-perfschema" to the configure options.- User "usr/lib*" to allow for both "usr/lib" and "usr/lib64",
  mask "rmdir" return code 1.
- Remove "ha_example.*" files from the list, they aren't built.- Fix a wrong path name in handling the debug plugins.- Take the result of the debug plugin build and put it into the optimized tree,
  so that it becomes part of the final installation;
  include the files in the packlist. Part of the fixes for bug#49022.- Set "Oracle and/or its affiliates" as the vendor and copyright owner,
  accept upgrading from packages showing MySQL or Sun as vendor.- Formatting changes:
  Have a consistent structure of separator lines and of indentation
  (8 leading blanks => tab).
- Introduce the variable "src_dir".
- Give the environment variables "MYSQL_BUILD_CC(CXX)" precedence
  over "CC" ("CXX").
- Drop the old "with_static" argument analysis, this is not supported
  in 5.1 since ages.
- Introduce variables to control the handlers individually, as well
  as other options.
- Use the new "--with-plugin" notation for the table handlers.
- Drop handling "/etc/rc.d/init.d/mysql", the switch to "/etc/init.d/mysql"
  was done back in 2002 already.
- Make "--with-zlib-dir=bundled" the default, add an option to disable it.
- Add missing manual pages to the file list.
- Improve the runtime check for "libgcc.a", protect it against being tried
  with the Intel compiler "icc".- Change RPM file naming:
  - Suffix like "-m2", "-rc" becomes part of version as "_m2", "_rc".
  - Release counts from 1, not 0.- The "semisync" plugin file name has lost its introductory "lib",
  adapt the file lists for the subpackages.
  This is a part missing from the fix for bug#48351.
- Remove the "fix_privilege_tables" manual, it does not exist in 5.5
  (and likely, the whole script will go, too).- remove erroneous traces of the InnoDB plugin (that is 5.1 only).- Removed mysql_fix_privilege_tables- "mysqlmanager" got removed from version 5.4, all references deleted.- Merge up from 5.1 to 5.4: Remove handling for the InnoDB plugin.- This version does not contain the "Instance manager", "mysqlmanager":
  Remove it from the spec file so that packaging succeeds.- Add conditionals for bundled zlib and innodb plugin- Install plugin libraries in appropriate packages.
- Disable libdaemon_example and ftexample plugins.- Update variable used for mysql-test suite location to match source.- Correct yesterday's fix, so that it also works for the last flag,
  and fix a wrong quoting: un-quoted quote marks must not be escaped.- Removed "mysql_upgrade_shell"
- Removed some copy/paste between debug and normal build- Modify CFLAGS and CXXFLAGS such that a debug build is not optimized.
  This should cover both gcc and icc flags.  Fixes bug#40546.- Removed the "Federated" storage engine option�x������������������X�
ab�?fb3e��������������edE�$@����������������
���
�est when sending requests to kdcs- fix combination of --with-netlib and --enable-dns (#82176)- remove libdefault ticket_lifetime option from the default krb5.conf, it is
  ignored by libkrb5- fix bug in patch to make rlogind start login with a clean environment a la
  netkit rlogin, spotted and fixed by Scott McClung- include profile.d scriptlets in krb5-devel so that krb5-config will be in
  the path if krb5-workstation isn't installed, reported by Kir Kolyshkin- add more etypes (arcfour) to the default enctype list in kdc.conf
- don't apply previous patch, refused upstream- fix 32/64-bit bug storing and retrieving the issue_date in v4 credentials- Don't check for write access on /etc/krb5.conf if SELinux- fixup some int/pointer varargs wackiness- rebuild- update to 1.3.1- pull fix for non-compliant encoding of salt field in etype-info2 preauth
  data from 1.3.1 beta 1, until 1.3.1 is released.- update to 1.3- correctly use stdargs- test update to 1.3 beta 4
- ditch statglue build option
- krb5-devel requires e2fsprogs-devel, which now provides libss and libcom_err- rebuilt- gcc 3.3 doesn't implement varargs.h, include stdarg.h instead- update to 1.2.8- fix double-free of enc_part2 in krb524d- update to latest patch kit for MITKRB5-SA-2003-004- add patch included in MITKRB5-SA-2003-003 (CAN-2003-0028)- add patches from patchkit from MITKRB5-SA-2003-004 (CAN-2003-0138 and
  CAN-2003-0139)- rebuild- fix buffer underrun in unparsing certain principals (CAN-2003-0082)- add patch to document the reject-bad-transited option in kdc.conf- add patch to fix server-side crashes when principals have no
  components (CAN-2003-0072)- add patch from Mark Cox for exploitable bugs in ftp client- rebuilt- use PICFLAGS when building code from the ktany patch- debloat- include .so.* symlinks as well as .so.*.*- always #include <errno.h> to access errno, never do it directly
- enable LFS on a bunch of other 32-bit arches- increase the maximum name length allowed by kuserok() to the higher value
  used in development versions- install src/krb524/README as README.krb524 in the -servers package,
  includes information about converting for AFS principals- update to 1.2.7
- disable use of tcl- update to 1.2.7-beta2 (internal only, not for release), dropping dnsparse
  and kadmind4 fixes- add patch for buffer overflow in kadmind4 (not used by default)- drop a hunk from the dnsparse patch which is actually redundant (thanks to
  Tom Yu)- patch to handle truncated dns responses- remove hashless key types from the default kdc.conf, they're not supposed to
  be there, noted by Sam Hartman on krbdev- update to 1.2.6- use %{_lib} for the sake of multilib systems- add patch from Tom Yu for exploitable bugs in rpc code used in kadmind- fix bug in krb5.csh which would cause the path check to always succeed- build even libdb.a with -fPIC and $RPM_OPT_FLAGS.- automated rebuild- automated rebuild- update to 1.2.5
- disable statglue- update to 1.2.4- rebuild in new environment
- reenable statglue- prereq chkconfig for the server subpackage- build without -g3, which gives us large static libraries in -devel- reintroduce ld.so.conf munging in the -libs %post- rename the krb5 package back to krb5-libs; the previous rename caused
  something of an uproar
- update to 1.2.3, which includes the FTP and telnetd fixes
- configure without --enable-dns-for-kdc --enable-dns-for-realm, which now set
  the default behavior instead of enabling the feature (the feature is enabled
  by --enable-dns, which we still use)
- reenable optimizations on Alpha
- support more encryption types in the default kdc.conf (heads-up from post
  to comp.protocols.kerberos by Jason Heiss)- rename the krb5-libs package to krb5 (naming a subpackage -libs when there
  is no main package is silly)
- move defaults for PAM to the appdefaults section of krb5.conf -- this is
  the area where the krb5_appdefault_* functions look for settings)
- disable statglue (warning: breaks binary compatibility with previous
  packages,�x�������������������X�
/�?/shaXX������0�����_AGES�$����������������
�_�_�_
�hat.com> 1:3.0pl2-6.13Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.12Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.11Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.10Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.9Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.8Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.7Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.6Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.5Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.4Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.3Tim Powers <timp@redhat.com> 1:3.0pl2-6.1Elliot Lee <sopwith@redhat.com>Dan Walsh <dwalsh@redhat.com> 3.0pl2-5Dan Walsh <dwalsh@redhat.com> 3.0pl2-4Dan Walsh <dwalsh@redhat.com> 3.0pl2-3Dan Walsh <dwalsh@redhat.com> 3.0pl2-2Dan Walsh <dwalsh@redhat.com> 3.0pl2-1Dan Walsh <dwalsh@redhat.com> 3.0pl1-26Dan Walsh <dwalsh@redhat.com> 3.0pl1-25Dan Walsh <dwalsh@redhat.com> 3.0pl1-24Dan Walsh <dwalsh@redhat.com> 3.0pl1-23Dan Walsh <dwalsh@redhat.com> 3.0pl1-22Dan Walsh <dwalsh@redhat.com> 3.0pl1-21Dan Walsh <dwalsh@redhat.com> 3.0pl1-20Florian La Roche <Florian.LaRoche@redhat.de>Dan Walsh <dwalsh@redhat.com> 3.0pl1-17Dan Walsh <dwalsh@redhat.com> 3.0pl1-16Tim Powers <timp@redhat.com>Dan Walsh <dwalsh@redhat.com> 3.0pl1-15Dan Walsh <dwalsh@redhat.com> 3.0pl1-14Dan Walsh <dwalsh@redhat.com> 3.0pl1-13Dan Walsh <dwalsh@redhat.com> 3.0pl1-12Elliot Lee <sopwith@redhat.com> 3.0pl1-11Preston Brown <pbrown@redhat.com> 3.0pl1-10Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 3.0pl1-9Elliot Lee <sopwith@redhat.com> 3.0pl1-8Elliot Lee <sopwith@redhat.com> 3.0pl1-7Elliot Lee <sopwith@redhat.com> 3.0pl1-6Elliot Lee <sopwith@redhat.com> 3.0pl1-5Elliot Lee <sopwith@redhat.com> 3.0pl1-4Elliot Lee <sopwith@redhat.com> 3.0pl1-3David Sainty <saint@redhat.com> 3.0pl1-2David Sainty <saint@redhat.com> 3.0pl1-1Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 3.0-5Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 3.0-3Elliot Lee <sopwith@redhat.com> 3.0-2Elliot Lee <sopwith@redhat.com> 2.0pl5-8Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Tim Waugh <twaugh@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Matt Wilson <msw@redhat.com>Preston Brown <pbrown@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Prospector <bugzilla@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Preston Brown <pbrown@redhat.com>Erik Troan <ewt@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Preston Brown <pbrown@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com> Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Bryan C. Andregg <bandregg@redhat.com>Mike Wangsmo <wanger@redhat.com>Bryan C. Andregg <bandregg@redhat.com>- Change bug tracker path- Rebuild because of bind ABI changes related to CVE-2023-50387- Fix for CVE-2022-2928
- Fix for CVE-2022-2929
- send back dhcp6.vendor-opts again (#2142024)- omshell: add support for hmac-sha512 algorithm (#2016248)- Rebuilt on a new side-tag (#2022715)- Rebuild with new bind (#2022715)- Fix for  CVE-2021-25217- Rebuild with new bind (#1904613)- Drop 12-dhcp NM dispatchers script (#1898423)- Add key-algorithm support.
- Resolves: rhbz#1883999- Rebuild with bind-9.11.18- Rebuild with bind-9.11.13 again- Resolves: #1757475 - Close replay files properly- Rebuild with bind-9.11.13- Resolves: #1729211 - detect system time changes with monotonic timer- Resolves: #1757475 - fix FD leak in nonreplay mode- Rebuild with bind-9.11- Resolves: #1704672 - Fix crash caused by bind rebase- Resolves: #1673946 - Change default pr�x�������������������X�
ki�?ora_��������h.���u_rl 5�$e����������������
u_v_
.gz/usr/share/doc//usr/share/doc/dhcp-common//usr/share/licenses//usr/share/licenses/dhcp-common//usr/share/man/man5/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu


directoryASCII textUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)utf-83ad6a7cfd174f49b1b9772068b72de74f51d844497ffdbe35ff9d4fd19021210?���`(ĉ3
!pQ�p�)�Tξ7��]�mtZ`f��
	�]�mtZ`?T�G���-q�ΑM=�"��֡ق�y3�ZB��n����V�̂��r��L����ɥ�Y3DIb�Ai���w����U��#8��z�6�bTu�5�����R�JH��Ɩ>����3�s���V��X�%۰���>�EHA����(8�������UrY��m�M��[Q-�'�l̻@8��K�g�����3;!�(u��~��*Ob+ȍ��3K���V�w��ςh��	B;�nn�@�Ka|����A'ۀg^�n.�O#��Y�=��$�g
	`�YU'�Q��G	���†r�&Y�w5��84�x����E,�T�]�eS-+f�f�����"�ȱK��ޕ<���~C��}�^&g����n4�ԗ�\V1��m��~̶`�l4��ߥ�M���77^x��ר�%ρ?l�O��	&��o)�y�
;y.Vu�!���	8#�Ї��9FH�(šC��cjؒ�_G�ĬO�bJd)
����a��j6.B��E
�$]Bg	̚��V�v���W���$5��􊢉3
!pQ�p�)�Tξ7��]�mtZ`f��
	�]�mtZ`��G�{
Pp��m�\�������
"��d
_��;j�!	��N���h_�h4e!�q�7�f`N%�]՞R0'l���m�
t�b��C�s���XT��Ӷ���&w��	f֧
m��N3&�F����\g�V�V�:}�(��J�:��|À�����dz�x!�����x��w)|ȷ4Ρ�?$��m�ȕǼ�nZ�Z�ҵ�[
��]7U�k���0���]!6>/~��]�����tU#۽�9�
�`� �3ڤ-��
�Hl#�����J����?�@��J�Yf*NP��=V�_�q�i�=�To2葦�aSϯ�ʓ��Z3�ay�NAjH�'�{k-�����R�t�r���nLGR)t�E2��d5%y�9�.���3�
�9�y��
�Ŝ�Qغ��_k]q9�~)�Z�q���w�:A�^�|��0^թ*?�� �`_�=�E�&r�窣"t����ef%�^���O.���.@�w���,��.Toy�`�~K��605b2da59715dac7a0b36a1de523a1aa4835d8811d851150de0a683508c087b71ce583c5edbc17e98958778b20db1a7f488697b8fa�>� fa�la) [1869536]
- [sound] ALSA: ASoC: mediatek: mt8183-da7219: support machine driver with rt1015 (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: mediatek: mt8183-da7219: extract codec and DAI names (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: mediatek: mt8183-da7219: remove forward declaration of headset_init (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: mediatek: mt8183-da7219: sort header inclusions in alphabetical (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: rt286: fix unexpected interrupt happens (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: wm8974: remove unsupported clock mode (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: wm8974: fix Boost Mixer Aux Switch (Jaroslav Kysela) [1869536]
- [sound] ALSA: xen: Remove superfluous fall through comments (Jaroslav Kysela) [1869536]
- [sound] ALSA: atmel: Remove invalid "fall through" comments (Jaroslav Kysela) [1869536]
- [sound] ALSA: echoaudio: Address bugs in the interrupt handling (Jaroslav Kysela) [1869536]
- [sound] ALSA: echoaudio: Prevent some noise on unloading the module (Jaroslav Kysela) [1869536]
- [sound] ALSA: echoaudio: Prevent races in calls to set_audio_format() (Jaroslav Kysela) [1869536]
- [sound] ALSA: echoaudio: Race conditions around "opencount" (Jaroslav Kysela) [1869536]
- [sound] ALSA: echoaudio: Remove redundant check (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: amd: fixed kernel warnings (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: mediatek: mt8183: support machine driver with rt1015 (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: mediatek: mt8183: sort header inclusions in alphabetical (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: qdsp6: use dev_err instead of pr_err (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: q6asm: add command opcode to timeout error report (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoC: SOF: core: fix null-ptr-deref bug during device removal (Jaroslav Kysela) [1869536]
- [sound] ALSA: ASoc: codecs: max98373: remove Idle_bias�x�������������p�����X�
XP�?pporhy�����������.� for�$>����������������
.�-�
�LTl?O�d
�
�
�
�	
�	[
�

�
 
�
P
�
T
�
b
�
h
�
w
�	
�
�
�
�
�
�
�

�
�	�
�	
h
�
D
��
�s*
�
�
��<
���
���
��
��\�D3�3�*3(��
8��
�9�8
�:��
�>
�
@
��
G
��
�H
�X
�I
�
�X
��Y
�\
�\
�]
�
�^
��bA
d
�
e
�
f
�
l
�
t
�
�u	l
�v$Ew5@
�x<�
�yD���O$
�O(
�OD
�OS
�OX
�O\
�Ob
�O�


O�

O�
O�6

R

R+
�Rl

Rp
�T`
gTd
hTh
Cpam1.3.139.el8_10An extensible library which provides authentication for applicationsPAM (Pluggable Authentication Modules) is a system security tool that
allows system administrators to set authentication policy without
having to recompile programs that handle authentication.iC	Vord1-prod-x86build008.svc.aws.rockylinux.org(�WRocky Linux 8RockyBSD and GPLv2+infrastructure@rockylinux.orgSystem Environment/Basehttp://www.linux-pam.org/linuxx86_64����
����Rp��3	v���
��+ 0-,&//*,,+-+/-(**0,-&,**/.)*/,/'4,.%+-/)., .+.,+/,.**+%�
�@�@�N�-�qhN(.8�.PN�>0-�`�>H1-�>8..HN�^... >-�.8�h. �`0-�.(.(^�>8.>x>h>(a>0-��>8.P.^Ra���/xQ��p�p�W#�'��Do�!^�;F�O/�`x1� ��$~;'��g!LF�)&FYR4IP���!�P y�#�%���:�!��
 ���q�s���&�L+�;��L�
%	u*�]�Q
-D�
Z�Z>>]p�0P
�_a����o�F�


�#@@�
�X7�CC	
U-'-R6*�,�
�"
.���,q-�/�@!<�T,m,�H
,0m
7�10D�,f
�
�
�
�M.,O�
AW3*
�
,

�E�=}.=-;+�5:�/�,@A8*�+!DBD	
+�
�;
�-�
�
�($
�(��
�
�
�R�'�+@<#Q������w��y�xK����v���(j/	)����q
�_��}�0����7��4�B;��`hA�A큤������������A큤��A큤��A큤����A큤A�큀��������A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A���A�A���A�A�A�A�A�A�A���A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A���A�A�A�A�A�A�A���A�A�A큤��������A������������A�������������������������������������������x������������������X�
-7�?i PoX������������՞at.c�$E����������������
՞Ԟ˞
�- reworked the package descriptions- Added embedded server as a separate RPM- Added mysqld-max to the distribution- Added mysql-test to the bench package- Added separate libmysql_r directory; now both a threaded
  and non-threaded library is shipped.- Added the support-files/my-example.cnf to the docs directory.

- Removed devel dependency on base since it is about client
  development.- Cleaned up some for 3.23.- Added support for shared libraries in a separate sub
  package. Original fix by David Fox (dsfox@cogsci.ucsd.edu)

- The --enable-assembler switch is now automatically disables on
  platforms there assembler code is unavailable. This should allow
  building this RPM on non i386 systems.- Removed unportable cc switches from the spec file. The defaults can
  now be overridden with environment variables. This feature is used
  to compile the official RPM with optimal (but compiler version
  specific) switches.

- Removed the repetitive description parts for the sub rpms. Maybe add
  again if RPM gets a multiline macro capability.

- Added support for a pt_BR translation. Translation contributed by
  Jorge Godoy <jorge@bestway.com.br>.- A lot of changes in all the rpm and install scripts. This may even
  be a working RPM :-)- A developers changelog for MySQL is available in the source RPM. And
  there is a history of major user visible changed in the Reference
  Manual.  Only RPM specific changes will be documented here./bin/sh/bin/shmariadb-libsminimal-centos-6-x32-2258 1606088872










	
���5.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el85.7.32-35.1.el8
mysql-x86_64.conf.build-id6b6c975e9be3389953ca11c880cf30bbd36573866c975e9be3389953ca11c880cf30bbd3657386.1mysqllibmysqlclient.so.18.1.0libmysqlclient_r.so.18.1.0Percona-Server-shared-compat-57README/etc/ld.so.conf.d//usr/lib//usr/lib/.build-id//usr/lib/.build-id/6b//usr/lib64//usr/lib64/mysql//usr/share/doc//usr/share/doc/Percona-Server-shared-compat-57/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu



ASCII textdirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6b6c975e9be3389953ca11c880cf30bbd3657386, strippedPPPPR
RR
RRRRRRRRRRRR	RRRRRRPPPPR
RR
RRRRRRRRRRRR	RRRRRRutf-89b83c481f4d7aecb9d050e55642b9b4bb9128c56a918d20c315694ab0586f8fb?�����$�
_���
	�4�_���h�V�3�4���(����S>��D9zhb�lN��G=���^[���@|�^(uB�)�ٯ�w�I��^�B��4�a&f�������T���O��j<�
l�E(qi�I�kP��ޯ�VbĄ�;V)�ŧq������7R4'��:*����gc�N�O?8���-�פ��!�Z�N�s�y"n�c4����nO�͏o���˜�=�'�Fe��'�ήr����ϛ�hS�W)j*�m�!-#�g�d0���74}�m�%�5�2iw_��E#�V�
I�e��
�rim�y!f�w��B(�<p�§������x�Mk�{)�@�
�oM�LD㴤kIi3�{���ɿ��GL�O�Zj�\�Y��O�ȡ���A5U��$�PMw��S���L*��uAe�-?- Ge�a��ĵ�su�U�{T����Np��a����@���1�kN �R�����>�^I�������q��o&�BJ]��_F��ό��X$�ZZ��&�c��rH�F�
�ga�FR

��)���
_���
	�4�_�凌���
�3�1���J�X/P�ӣ�2�[{����5T>X(�_�#X�b�i��V�O� �
��^����^�ײ��d��
�P��
��5�\k��
�mā:m�6 ������(��쥭���;�u"�x(������aLͨWw�hsK���8�a4Is��i�)�!".s/:z�
kh�M�e���c�8���dD�aA��!U��G �-�S��ylvnwb޹Hp�c-�Z����l�@._`~�^<��^E�B�}H�p@)�X�y*�_S�"7u��ߪMD��
��a�m|����̚����U���x�������������`o����X�
in�? pys������1Y�de t�$I����������������
Y�Z�X�
�ing unversioned executables (idle, msgfmt.py, pygettext.py,
  pynche, smtpd.py, python-config)
Resolves:             rhbz#1656511- Workaround Python's threading library issue with non returning wait, for signals with timeout
Resolves:             rhbz#1653754- Add choices for sort option of cProfile for better output
Resolves:             rhbz#1649473- Bring audiotest.au back to package. It's not copyrighted anymore.
- Resolves: rhbz#1647692- Slightly edit the description
- Related: rhbz#1633537- Add Requires (/post/postun) on /usr/sbin/alternatives
- Resolves: rhbz#1633537- Don't list /usr/bin/python as a ghost file so `yum install /usr/bin/python`
  doesn't install this package
- Resolves: rhbz#1633537- Remove Windows binaries from the source archive
- Resolves: rhbz#1633220- Fix test_dbm_gnu for gdbm 1.15 which fails on ppc64le
Resolves:             rhbz#1638716- Security fix for CVE-2018-14647
Resolves:             rhbz#1632095- Set a special Provides tag that advertises the `python2` package as an
  alternative to the non-existing `python` package
- Resolves: rhbz#1633559- Remove unversioned provides
- Resolves: rhbz#1628242- Implement the alternatives system for Python in RHEL8
- Resolves: rhbz#1633537- Remove unversioned symlink to manual page and to pydoc binary.
  They are both available in streams of `python` module.
- Resolves: rhbz#1613343- Disable optimizations
- Disable ssl related tests for now- Hotfix issue with byte compilation macro - rhbz#1597664- Remove the /usr/bin/python executable so that the user can chose where it
  points to by installing various streams of the `python` module- Fix loading of the gdb python plugin (rhbz#1578001)- Update to version 2.7.15- Change shebangs to the proper versioned binary
- Bytecompile files manually, disbale brp-python-bytecompile
Resolves:             rhbz#1572171- Remove Obsoletes tag from when python was renamed to python2 (Fedora 25 was last)- Fix broken SSL module
Resolves:             rhbz#1555081- Do not send IP addresses in SNI TLS extension- Fix -Wint-in-bool-context warnings
Resolves:             rhbz#1473425- Rebuild with new LDFLAGS from redhat-rpm-config- Move test.support and test.script_helper to python2-libs
Resolves:             rhbz#1528899- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Add patch 288: warn/fail if Python 2 is called as /usr/bin/python and
  PYTHON_DISALLOW_AMBIGUOUS_VERSION is set
- Add patch 289: Fix for over-aligned GC info- Rebuilt for switch to libxcrypt- Build the nis module with tirpc- Rebuild for reverted gdbm 1.13 on Fedora 27- Rebuild for gdbm 1.14- Fix hanging of all threads when trying to access an inaccessible NFS server.- Make the -devel package require redhat-rpm-config
Resolves:             rhbz#1496757- Add a new PYTHONSHOWREFCOUNT environment variable for printing the reference
  count in debug builds.
- Fix nondeterministic read in test_pty.- Update to version 2.7.14- Switch some macros into bconds to facilitate modularity- Exclude /usr/bin/2to3 (rhbz#1111275)- Do not generate debuginfo subpackages (#1476593)- Revert "Add --executable option to install.py command"
  This enhancement is currently not needed and it can possibly
  collide with `pip --editable`option- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Fix test_alpn_protocols from test_ssl- Change fixed Obsoletes version with a dynamic one (rhbz#1457336)- revert logic for modularity patch and enable gdbm for modularity- Added a dependency to the devel subpackage on python3-rpm-generators which
  have been excised out of rpm-build
- There is no Python 2 package containing Python RPM generators, therefore
  Python 3 is needed when Python 2 package is to be built, but this was
  decided not to be a problem due to nearing EOL of Python 2
- Involves: rhbz#1410631, rhbz#1444925- Enable profile guided optimizations for x86_64 and i686 architectures
- Update description to refl�x��������������^����X�
be�?70df�����i����_8d10�$����������������
�_�_�_
�ones <pjones@redhat.com> - 12:3.0.4-17Florian La Roche <laroche@redhat.com> - 12:3.0.4-16Peter Jones <pjones@redhat.com> - 12:3.0.4-15Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-14Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-12Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-10Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-8.1Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-8Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-4Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-2Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-2Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-2Jason Vas Dias <jvdias@redhat.com> - 12:3.0.4-1Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-26Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-24Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-22Jesse Keating <jkeating@redhat.com> - 11:3.0.3-21.1.1Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-21.1Dan Williams <dcbw@redhat.com> - 11:3.0.3-21Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-20Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-18Jesse Keating <jkeating@redhat.com>Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-16Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-12Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-11Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-10Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-8Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-7Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-6Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-4Jason Vas Dias <jvdias@redhat.com> - 11:3.0.3-3Jeremy Katz <katzj@redhat.com> - 11:3.0.3-2Jason Vas Dias <jvdias@redhat.com> 11:3.0.3-1Jason Vas Dias <jvdias@redhat.com> 10:3.0.3rc1-1Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-14.FC5Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-14Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-12Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-11Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-10Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-9Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-8Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-7Florian La Roche <laroche@redhat.com>Jason Vas Dias <jvdias@redhat.com> 10.3.0.2-3Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-2Jason Vas Dias <jvdias@redhat.com> 10:3.0.2-1Jason Vas Dias <jvdias@redhat.com> 8:3.0.2rc3-8Jason Vas Dias <jvdias@redhat.com> 8:3.0.2rc3-4Jason Vas Dias <jvdias@redhat.com> 3.0.2rc3-4Jason Vas Dias <jvdias@redhat.com> 8.3.0.4rc3-3Jason Vas Dias <jvdias@redhat.com> 8:3.0.2rc3-2Jason Vas Dias <jvdias@redhat.com> 8:3.0.2rc3-1Jason Vas Dias <jvdias@redhat.com> 3.0.2rc3-1Jason Vas Dias <jvdias@redhat.com> 3.0.2rc3-1Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-17Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-16Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-14Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-12Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-11Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-10Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-9Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-8Jason Vas Dias <jvdias@redhat.com> 7:3.0.1-7Jason Vas Dias <jvdias@redhat.com> 6:3.0.1-6Jason Vas Dias <jvdias@redhat.com> 5:3.0.1-5Jason Vas Dias <jvdias@redhat.com> 3:3.0.1Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc14-5Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc14-4Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc14-2Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc14-1Elliot Lee <sopwith@redhat.com>Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc13-1Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc12-9Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc12-8Bill Nottingham <notting@redhat.com> 1:3.0.1rc12-7Thomas Woerner <twoerner@redhat.com> 1:3.0.1rc12-6Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc12-5Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc12-4Dan Walsh <dwalsh@redhat.com> 1:3.0.1rc12-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.20Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.19Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.18Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.17Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.16Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.15Dan Walsh <dwalsh@redhat.com> 1:3.0pl2-6.14Dan Walsh <dwalsh@red�x�������������PN����X�
.c�?- 12������H�������9a <j�$C����������������
�9�9�9
�m.build-id23e1a01098b3314c1eaee31b2398499223f156a52cb380cd078355426fcead6f991d6059646aed274042fdf58b284715ba7e7749bb9865b99a2d19ee43f96270833ccc458bddc67be295469cf9399a2446bd6823ca771c4e8280193341e1a43cc04a69e061c115b13e9a2193bccbe73e2b6a51d436be81e56303b66f87cadbd52d3e9c517e73f327782213d565f4e4a3cf6c4f4e8bbab1dc1de5ca1c05b6204a67fcf40d3aa656c0d182acbd8bc3649ae7ea916776e1de4ddd56fe2bec21d088427a09303af4a12d7ed2b48016a058b19e2195ecf918288d4e38d2c082a47dc92b0faddb4ddefa97ea53ab9d29d7e2568ba4040b80f2465d32249174c5b2e62381e2cdc499b958bb264d97143a6bd53eb3b923d58dd5b1c9a17af47015992e8edf5e4905ff4909b1f27fd9ebadc6ed359c6620b24ef90950c839ef33a4949916d1522a07db1342a7b692711dda429d387c0401c3dcf5a2caeeb90fac772e61ee69fda0f371ac256be2b0960b1e18564585eec8ead00f14582cc82d49f0396ace7eeeb3f88bf3bee76ea6eaa7c4cc40d0libqdbm.so.14libqdbm.so.14.14.0qdbmCOPYINGChangeLogNEWSREADMETHANKSicon16.pngindex.htmlindex.ja.htmllogo.pngcbcodec.1.gzcbtest.1.gzcrmgr.1.gzcrtest.1.gzcrtsv.1.gzdpmgr.1.gzdptest.1.gzdptsv.1.gzhvmgr.1.gzhvtest.1.gzodidx.1.gzodmgr.1.gzodtest.1.gzqmttest.1.gzrlmgr.1.gzrltest.1.gzvlmgr.1.gzvltest.1.gzvltsv.1.gz/usr/bin//usr/include//usr/lib//usr/lib/.build-id//usr/lib/.build-id/23//usr/lib/.build-id/2c//usr/lib/.build-id/40//usr/lib/.build-id/43//usr/lib/.build-id/46//usr/lib/.build-id/61//usr/lib/.build-id/63//usr/lib/.build-id/65//usr/lib/.build-id/67//usr/lib/.build-id/76//usr/lib/.build-id/7e//usr/lib/.build-id/82//usr/lib/.build-id/8b//usr/lib/.build-id/99//usr/lib/.build-id/a1//usr/lib/.build-id/ad//usr/lib/.build-id/d1//usr/lib/.build-id/dc//usr/lib/.build-id/e2//usr/lib/.build-id/f0//usr/lib64//usr/share/doc//usr/share/doc/qdbm//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu
	

ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f0396ace7eeeb3f88bf3bee76ea6eaa7c4cc40d0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d1522a07db1342a7b692711dda429d387c0401c3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6303b66f87cadbd52d3e9c517e73f327782213d5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=82a47dc92b0faddb4ddefa97ea53ab9d29d7e256, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=67fcf40d3aa656c0d182acbd8bc3649ae7ea9167, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e2b0960b1e18564585e�x��������������=����X�
do?ojech������HT���ِRem�$I����������������
ِؐڐ
�mysqlmysql_config_editormysqladminmysqlbinlogmysqlcheckmysqldumpmysqlimportmysqlpumpmysqlshowmysqlslap.build-id7537e380017d83ef15903dddfb0abaa6a9c7ed696208d0e1d96a8cb798f41621f642cc0268cc91734a12a5e4638cc09b4a75858dc717797d74624da50b29bb345afc997e2bebcf7d003755ceac6529d84236792f7a07e3abc46ee3403dc509faa3a42701780611cbf82875fac07158d897252f0d5fb4977b39dbec33aad9ac999dbae1d09df8353dcef550533caa9f4ca0f588daf4731fcf9b6549e8cfee86ec89dd9e3bd32ae8e2a426f90ce8440f7ff6f9eaa4bee0124fb5ab99f5cca23859afe89230Percona-Server-client-57READMEmysql.1.gzmysql_config_editor.1.gzmysqladmin.1.gzmysqlbinlog.1.gzmysqlcheck.1.gzmysqldump.1.gzmysqlimport.1.gzmysqlpump.1.gzmysqlshow.1.gzmysqlslap.1.gz/usr/bin//usr/lib//usr/lib/.build-id/10//usr/lib/.build-id/24//usr/lib/.build-id/5a//usr/lib/.build-id//usr/lib/.build-id/62//usr/lib/.build-id//usr/lib/.build-id/65//usr/lib/.build-id//usr/lib/.build-id/a4//usr/lib/.build-id/b4//usr/lib/.build-id/b7//usr/lib/.build-id//usr/lib/.build-id/cf//usr/lib/.build-id/f6//usr/share/doc//usr/share/doc/Percona-Server-client-57//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu
	

















ELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=107537e380017d83ef15903dddfb0abaa6a9c7ed, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6529d84236792f7a07e3abc46ee3403dc509faa3, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cfee86ec89dd9e3bd32ae8e2a426f90ce8440f7f, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a42701780611cbf82875fac07158d897252f0d5f, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5a91734a12a5e4638cc09b4a75858dc717797d74, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b4977b39dbec33aad9ac999dbae1d09df8353dce, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=24696208d0e1d96a8cb798f41621f642cc0268cc, strippedELF 64-bit LSB executable, x86-64, version 1 (GNU/Linux), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b7f550533caa9f4ca0f588daf4731fcf9b6549e8, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=624da50b29bb345afc997e2bebcf7d003755ceac, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f6f9eaa4bee0124fb5ab99f5cca23859afe89230, strippeddirectoryASCII texttroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)/Gb{�����x�������������@-����X�
sh�?a242������XQ�������4208�$L����������������
���
�e keyctl_get_persistent() (more of #991148)- incorporate Simo's updated backport of his updated persistent-keyring changes
  (more of #991148)- don't break during %check when the session keyring is revoked- pull the newer F21 defaults back to F20 (sgallagh)- only apply the patch to autocreate /run/user/0 when we're hard-wiring the
  default ccache location to be under it; otherwise it's unnecessary- don't let comments intended for one scriptlet become part of the "script"
  that gets passed to ldconfig as part of another one (Mattias Ellert, #1005675)- incorporate Simo's backport of his persistent-keyring changes (#991148)
- restore build-time default DEFCCNAME on Fedora 21 and later and EL, and
  instead set default_ccache_name in the default krb5.conf's [libdefaults]
  section (#991148)
- on releases where we expect krb5.conf to be configured with a
  default_ccache_name, add it whenever we upgrade from an older version of
  the package that wouldn't have included it in its default configuration
  file (#991148)- take another stab at accounting for UnversionedDocdirs for the -libs
  subpackage (spotted by ssorce)
- switch to just the snapshot of nss_wrapper we were using, since we
  no longer need to carry anything that isn't in the cwrap.org repository
  (ssorce)- drop a patch we weren't not applying (build tooling)
- wrap kadmind and kpropd in scripts which check for the presence/absence
  of files which dictate particular exit codes before exec'ing the actual
  binaries, instead of trying to use ConditionPathExists in the unit files
  to accomplish that, so that we exit with failure properly when what we
  expect isn't actually in effect on the system (#800343)- attempt to account for UnversionedDocdirs for the -libs subpackage- tweak configuration files used during tests to try to reduce the number
  of conflicts encountered when builds for multiple arches land on the same
  builder- pull up changes to allow GSSAPI modules to provide more functions
  (RT#7682, #986564/#986565)- use (a bundled, for now, copy of) nss_wrapper to let us run some of the
  self-tests at build-time in more places than we could previously (#978756)
- cover inconsistencies in whether or not there's a local caching nameserver
  that's willing to answer when the build environment doesn't have a
  resolver configuration, so that nss_wrapper's faking of the local
  hostname can be complete- specify dependencies on the same arch of krb5-libs by using the %{?_isa}
  suffix, to avoid dragging 32-bit libraries onto 64-bit systems (#980155)- special-case /run/user/0, attempting to create it when resolving a
  directory cache below it fails due to ENOENT and we find that it doesn't
  already exist, either, before attempting to create the directory cache
  (maybe helping, maybe just making things more confusing for #961235)- update to 1.11.3
  - drop patch for RT#7605, fixed in this release
  - drop patch for CVE-2002-2443, fixed in this release
  - drop patch for RT#7369, fixed in this release
- pull upstream fix for breaking t_skew.py by adding the patch for #961221- respin with updated version of patch for RT#7650 (#969331)- don't forget to set the SELinux label when creating the directory for
  a DIR: ccache
- pull in proposed fix for attempts to get initial creds, which end up
  following referrals, incorrectly trying to always use master KDCs if
  they talked to a master at any point (should fix RT#7650)- pull in patches from master to not test GSSRPC-over-UDP and to not
  depend on the portmapper, which are areas where our build systems
  often give us trouble, too- backport fix for not being able to verify the list of transited realms
  in GSS acceptors (RT#7639, #959685)
- backport fix for not being able to pass an empty password to the
  get-init-creds APIs and have them actually use it (RT#7642, #960001)
- add backported proposed fix to use the unauthenticated server time
  as the basis for computing the requested credential expiration times,
  rather than the client's idea of the current time, w�x������������������X�
gi�?ing Ȕ؝�apro�${����������������
���
�K@Z�Z�@Z�@Z�@Z��Z��Z�U�Z�l�Z�@Z��@Z�2@Z�2@Z�2@Z���Z���Z���Z��@Z��Z��@Z��@Z��@Z���Zz�@Zu�@Zo�Z/�Z'�Z�@Y�+@Y��Y�d�Y��Y��@Y��Y��@Y���Y���Y�@Y��@Y��@Y�3�Y���Y���Yx�@Yp�@YoI�YoI�Y^&@YP�@YP�@YM�Y7�Y%u�Y.�X�Q@X�h@X�h@X�@X�g@X���X�Z�X���X��X��X���X���XEV�X,J@X$a@X��W��@W�S�W�S�W�S�W��W��@W��@W�#�W�#�W��W���W�@W��W��W�9�W��Wj}�Wb��WH6�W��WW@V��V�@V�2�V�@V��V�@V�=@V��V��@V��@V��@V�v�V�v�V���VqR@V`.�VTQ@VR��VI�@V9�@V/g@V(�V(�V$�@V$�@V�@VZ�V
 @V�@V�@V�@U�p�U�p�U��@U��@U���U�a@Um��U]�UT�@UG_@U�@U
�@T��@T�	�T�	�T�f�T�,@T���T�p@TP�TP�T*�@T)I�T
�@S�v�S�0�S�S�@S�@S�j@S��S�i@S�#@S���S�h@S��@S�P@S�@S
��R��R�@R�@R�a@R�@R��@RΏ@RΏ@Rʚ�R�T�R�T�R��R��R��R��@R��@R��@R�S�R�v@R�R�R�
@R�@R�@R��Rx�Rw�@Rfh�R_�@R^�R].@R[�R[�RN��RL
�RIg�RD!�RB�@RB�@RA~�R@-@R:�@R2�@R2�@R-�@R-�@R)�RN�R�Q�Y@Q�d�Q��Q�*@Q�o@Q��@Q��Q���Q�?@Q�?@Q��@Q�a�Q��Q~`�Qvw�Qn��Qk�Qg�@Qd�Q\�QT0�QQ��QG
�Q=�@Q/F�Q-�@Q+R@Q�P�Z�P��@P��@P��@P�*�P�*�P��@P~��Pa��PM�@PI�PH�@P?U�P?U�P#�@Pk�Pk�P�P��O�^@O��OȮ�O��@O��@Ohq@OY�OWM�OC�@O'�O&�@O&�@O!@@O�@O
y�O?@N�x�N�>@N��N��N�T@N��@N�j@N��N��N�R@N��@Nw.�Nf@N_s�N^"@N?�N)f@N&�@N%q�N*�M�6@M�M@M�M@M�@�M��@M��M‘@M��@M���M��@M�I@MT�M]
�M[�@MR��MQ0@MO�MO�MG��M@�M�@ME@M	�@L��@L�7�L��L�@L���L���L�*@L��@L��@Ls�@LYV@L4l@LT@LT@L�L�@K�^�K�j@K�@K�@K͗@KŮ@K��K��@K��@K��@K�g@K�,�K��K��@K�O@K���K�f@K{�@Kz��Kie@K]��KY�@KTM@KPX�KO@KLd@KD{@KC)�KA�@KA�@K/c@K �K�@K?�K?�K��K�@K��J�J�k�J�0@J�G@J���J��@Ji�@JS8�JQ�@JI�@JI�@JH��JD�@J7�@J)�J'�@J�@J@I�X@I�@I�c�I�o@I�@@I��I���I�2�Ipv�H��H�@�H}�HwK@HS��H�@G�@G�#�G߮�G߮�G�@G­�G­�G­�G­�G�s@G��G��@G{|�Gg�@GV��G�@G�@Ga�G�@F�@F�@F��F�H�F��F�v�F���F�R@F�Q@F�@F�@F�@F~\�F~\�F~\�F{��F{��F{��FU~@FT,�FM�@FJ�@F; @F; @Fp�F�FA�Fo�Fo�E�{@E�5@E�n�E�@Eّ@E�3@E��@E��@E��@E�x@E���E�%�EE�@E<��E6@E6@E*9�E#�@D��@D�D�|�D�+@D��D��D�{�D��@D��@D���D��D�@Dq��DR�D?��C�@C�:@C�@C�@C�q�C��C|p�C&�@C��C��B�=�B@B@B�;�B���B���B���B{\@BAZ@B9q@B8�B��Aƾ�Aƾ�Aƾ�Aƾ�A��@A��A��A��A��A�%@Ao��A4h@A+-�A+-�A)�@A)�@AC�@��@͓@@�X�@�X�@�d@@�d@@�o�@�o�@��@~y@@{�@@O@@L`@@Dw@@,�@@'v@@;�@�@�@?��?�	�?r�?p5�?\o@?Xz�?U�?KK�?/�@?.J�?�@?�?	`�>�T@>��@>�j@>�@>�-�>z��>x[�>u��>g8@>g8@>?�@>>Y�>/�@>.��>%M@>d@>�@=�=��@=�K@=��=ϛ�=��@=��@=�@=�w@=�H@=��@=Jt@==E@=7�@=@<��@<��<m@<s��<R�@<Ek@<D�<=�@;j�@;j�@;g�@;X@;L?�;9�;5�@;�@;
T�:�
�:݁�:�u@:���:�t@:��:��@:�@:mr@:h,@:b�@:,�:'��9��@9�b�9�m@9��9��9��@9u�@9pR@9o�9m�@9i��9dt�9\��9[:@9Y�9WE�9N@9Kh@9H�@9Gs�9@�@9<�98�@9+�@9"��9!8@9�9�9�8��@8�*�8�8�A�8�@�8Ý�8��@8�W�8�c@8���8�V�8�m�8�J@8u�@8h�@8_k�8^@8\�7��@7���7�\@7��@7oz�7d�7=a�Julien Rische <jrische@redhat.com> - 1.18.2-32Julien Rische <jrische@redhat.com> - 1.18.2-31Julien Rische <jrische@redhat.com> - 1.18.2-30Julien Rische <jrische@redhat.com> - 1.18.2-29Julien Rische <jrische@redhat.com> - 1.18.2-28Julien Rische <jrische@redhat.com> - 1.18.2-27Julien Rische <jrische@redhat.com> - 1.18.2-26Julien Rische <jrische@redhat.com> - 1.18.2-25Julien Rische <jrische@redhat.com> - 1.18.2-24Julien Rische <jrische@redhat.com> - 1.18.2-23Julien Rische <jrische@redhat.com> - 1.18.2-22Julien Rische <jrische@redhat.com> - 1.18.2-21Julien Rische <jrische@redhat.com> - 1.18.2-19Julien Rische <jrische@redhat.com> - 1.18.2-18Julien Rische <jrische@redhat.com> - 1.18.2-15Robbie Harwood <rharwood@redhat.com> - 1.18.2-14Robbie Harwood <rharwood@redhat.com> - 1.18.2-13Robbie Harwood <rharwood@redhat.com> - 1.18.2-12Robbie Harwood <rharwood@redhat.com> - 1.18.2-11Robbie Harwood <rharwood@redhat.com> - 1.18.2-10Robbie Harwood <rharwood@redhat.com> - 1.18.2-9Robbie Harwood <rharwood@redhat.com> - 1.18.2-8Robbie Harwood <rharwood@redhat.com> - 1.18.2-7Robbie Harwood <rharwood@redhat.com> - 1.18.2-6Robbie Harwood <rharwood@redhat.com> - 1.18.2-5.2Robbie Harwood <rharwood@redhat.com> - 1.18.2-5.1Robbie Harwood <rharwood@redhat.com> - 1.18.2-5Robbie Harwood <rharwood@redhat.com> - 1.18.2-4Robbie Harwood <rharwood@redhat.com> - 1.18.2-3Ro�x�������������0����X�
38?- Reh�������P|
FN bec�$V����������������
FNGN
�cg�4踂�e|��+kF�'�D�y̆՟7NG
NYɿ������k�M�Q�^2[$�����_O�l�/@�F�0vmx^'�)�5Uc,L)d��������z�4F���؀�X��O���N��y:�r�w��)���>�V�P��O��Bi9������jW���*L�%�8�X������\
�M�����/�.
e��Z2C@T@ѵ*�h4���6���QY��y�z��9�xly6�'�R��8�P@K@�]Y�X��p��$6��3!�0�yG@s�J�S���Ț�e�͜�މG����9��ɵ��>oM�tn6LJ�~'��}�^J�����E?�;�s��Γ)���	;�UK\�
�s�U�'SPUIn]U��ƕ�o|�K�z24c52437d2c0d00a210749ce5a2fcd4a8abb3e7058d9711e9bdd7a0d4d7dba9004bd73061d6eeba3562e39b64bb4762035b56bc4fa�=�$fa�tdrv] net: phylink: delay MAC configuration for copper SFP modules (Petr Oros) [1816982]
- [netdrv] net: phylink: split phylink_sfp_module_insert() (Petr Oros) [1816982]
- [netdrv] net: phylink: split link_an_mode configured and current settings (Petr Oros) [1816982]
- [netdrv] net: phylink: support Clause 45 PHYs on SFP+ modules (Petr Oros) [1816982]
- [netdrv] net: phylink: re-split __phylink_connect_phy() (Petr Oros) [1816982]
- [netdrv] net: mdio-i2c: add support for Clause 45 accesses (Petr Oros) [1816982]
- [netdrv] net: sfp: move phy_start()/phy_stop() to phylink (Petr Oros) [1816982]
- [netdrv] net: sfp: add module start/stop upstream notifications (Petr Oros) [1816982]
- [netdrv] net: sfp: derive interface mode from ethtool link modes (Petr Oros) [1816982]
- [netdrv] net: sfp: remove incomplete 100BASE-FX and 100BASE-LX support (Petr Oros) [1816982]
- [netdrv] net: sfp: avoid tx-fault with Nokia GPON module (Petr Oros) [1816982]
- [netdrv] net: phy: dp83867: fix hfs boot in rgmii mode (Petr Oros) [1816982]
- [netdrv] phy: mdio-thunder: add missed pci_release_regions in remove (Petr Oros) [1816982]
- [netdrv] net: sfp: fix hwmon (Petr Oros) [1816982]
- [netdrv] net: sfp: fix unbind (Petr Oros) [1816982]
- [netdrv] net: phy: realtek: fix using paged operations with RTL8105e / RTL8208 (Petr Oros) [1816982]
- [netdrv] net: phy: Use the correct style for SPDX License Identifier (Petr Oros) [1816982]
- [netdrv] net: phy: dp83869: Fix return paths to return proper values (Petr Oros) [1816982]
- [netdrv] net: phy: add helpers phy_(un)lock_mdio_bus (Petr Oros) [1816982]
- [netdrv] mdio_bus: don't use managed reset-controller (Petr Oros) [1816982]
- [netdrv] net: phy: initialise phydev speed and duplex sanely (Petr Oros) [1816982]
- [netdrv] net: phy: remove phy_ethtool_sset() (Petr Oros) [1816982]
- [netdrv] net: sfp: soft status and control support (Petr Oros) [1816982]
- [netdrv] net: sfp: add some quirks for GPON modules (Petr Oros) [1816982]
- [netdrv] net: sfp: add support for module quirks (Petr Oros) [1816982]
- [netdrv] net: phylink: fix link mode modification in PHY mode (Petr Oros) [1816982]
- [netdrv] net: phylink: update documentation on create and destroy (Petr Oros) [1816982]
- [netdrv] mdio_bus: Fix init if CONFIG_RESET_CONTROLLER=n (Petr Oros) [1816982]
- [netdrv] net: phy: dp83869: fix return of uninitialized variable ret (Petr Oros) [1816982]
- [netdrv] phy: mdio-sun4i: add missed regulator_disable in remove (Petr Oros) [1816982]
- [netdrv] mscc.c: fix semicolon.cocci warnings (Petr Oros) [1816982]
- [netdrv] net: phy: avoid matching all-ones clause 45 PHY IDs (Petr Oros) [1816982]
- [netdrv] net: phylink: update to use phy_support_asym_pause() (Petr Oros) [1816982]
- [netdrv] net: phy: marvell10g: add SFP+ support (Petr Oros) [1816982]
- [netdrv] net: phy: add core phylib sfp support (Petr Oros) [1816982]
- [netdrv] net: phy: dp83869: Add TI dp83869 phy (Petr Oros) [1816982]
- [documentation] dt-bindings: net: dp83869: Add TI dp83869 phy (Petr Oros) [1816982]
- [netdrv] mscc.c: Add support for additional VSC PHYs (Petr Oros) [1816982]
- [netdrv] net: sfp: fix spelling mistake "requies" -> "requires" (Petr Oros) [1816982]
- [netdrv] net: sfp: allow modules with slow diagnostics to probe (Petr Oros) [1816982]
- [netdrv] net: sfp: allow sfp to probe slow to initialise GPON modules (Petr Oros) [1816982]
- [netdrv] net: sfp: move modu�x�������������������X�
67�?trip�6���h���ўhare�$A����������������
ўОҞ
�w ones. This is done by not using the implicitly generated capabilities
  (which include the configuration name) and relying on more generic ones which
  just list the function ("server", "client", ...).
  The implicit generation cannot be prevented, so all these capabilities must be
  explicitly listed in "Obsoletes:"- Add support for Oracle Linux 6 and Red Hat Enterprise Linux 6.  Due to
  changes in RPM behaviour ($RPM_BUILD_ROOT is removed prior to install)
  this necessitated a move of the libmygcc.a installation to the install
  phase, which is probably where it belonged in the first place.- "make_win_bin_dist" and its manual are dropped, cmake does it different.- Add mysql_plugin man page.- Set CXX=g++ by default to add a dependency on libgcc/libstdc++.
  Also, remove the use of the -fno-exceptions and -fno-rtti flags.
  TODO: update distro_buildreq/distro_requires- Add the manual page for "mysql_plugin" to the server package.- Null-upmerge the fix of bug#37165: This spec file is not affected.
- Replace "/var/lib/mysql" by the spec file variable "%{mysqldatadir}".- Source plugin library files list from cmake-generated file.- Added the mysql_plugin client - enables or disables plugins.- Fix bug#12561297: Added the MySQL embedded binary- Fix bug#45415: "rpm upgrade recreates test database"
  Let the creation of the "test" database happen only during a new installation,
  not in an RPM upgrade.
  This affects both the "mkdir" and the call of "mysql_install_db".- Fix bug#56581: If an installation deviates from the default file locations
  ("datadir" and "pid-file"), the mechanism to detect a running server (on upgrade)
  should still work, and use these locations.
  The problem was that the fix for bug#27072 did not check for local settings.- Install the new "manifest" files: "INFO_SRC" and "INFO_BIN".- EXCEPTIONS-CLIENT has been deleted, remove it from here too
- Support MYSQL_BUILD_MAKE_JFLAG environment variable for passing
  a '-j' argument to make.- Added test authentication (WL#1054) plugin binaries- Added example external authentication (WL#1054) plugin binaries- With a recent spec file cleanup, names have changed: A "-community" part was dropped.
  Reflect that in the "Obsoletes" specifications.
- Add a "triggerpostun" to handle the uninstall of the "-community" server RPM.
- This fixes bug#55015 "MySQL server is not restarted properly after RPM upgrade".- Change the behaviour on installation and upgrade:
  On installation, do not autostart the server.
  *Iff* the server was stopped before the upgrade is started, this is taken as a
  sign the administrator is handling that manually, and so the new server will
  not be started automatically at the end of the upgrade.
  The start/stop scripts will still be installed, so the server will be started
  on the next machine boot.
  This is the 5.5 version of fixing bug#27072 (RPM autostarting the server).- Implement SELinux checks from distribution-specific spec file.- Large number of changes to build using CMake
- Introduce distribution-specific RPMs
- Drop debuginfo, build all binaries with debug/symbols
- Remove __os_install_post, use native macro
- Remove _unpackaged_files_terminate_build, make it an error to have
  unpackaged files
- Remove cluster RPMs- Add "--with-perfschema" to the configure options.- User "usr/lib*" to allow for both "usr/lib" and "usr/lib64",
  mask "rmdir" return code 1.
- Remove "ha_example.*" files from the list, they aren't built.- Fix a wrong path name in handling the debug plugins.- Take the result of the debug plugin build and put it into the optimized tree,
  so that it becomes part of the final installation;
  include the files in the packlist. Part of the fixes for bug#49022.- Set "Oracle and/or its affiliates" as the vendor and copyright owner,
  accept upgrading from packages showing MySQL or Sun as vendor.- Formatting changes:
  Have a consistent structure of separator lines and of indentation
  (8 leading blanks => tab).
- Introduce the variable "src_dir".
- Give the environmen�x������������� �����X�
in�	?_suc��������@����%5 new�$5����������������
%5$5&5
�94c8b76a8fea7c0e4e5405be47fdbd0d2235bdca8f2804cc8808056dd50e3e621f0c87e21dcdca161489f24323a1fd904b923ed8dc90f96285182aa598cb33e256fafc652cfa94de49957bbf60f6fca9cb593199346e43a9774163aa074489693304bca8d682d4d038f4d6e205c1302700942bafa8f60319f9f61c34bdeeee936bb7eea0d8440eec06d15e48dcf923c46305cc41b2e67bc6c9b01441894f28c72e9335ffd9eeb97e669f9c516e31b0f6e676984c4c2d77498de6addc14be4d89f546b505570b9f50c6ac6edccb7d8468cbf1d710d7854fdf2d136b16bc5870755fca8f2f93d8fcb3a24cf0dff1b12c5516be91272728fb66ae9fa5bbea8ed62ef967320de40d769ca4510f50a6e15a64fb92d1f6b8a6b99a2436e8cd16c37923f0e77553d1c6ff212dd6d00a7bde5251f2d5fc4590f1d84253be36be38171d8ea828f62db419227be9f80d534026b50e827d0efd5de7775f12ea2f30d9c0d872dade345f30f562e6d93847b6a509ba53beec6d0b2c34628b001bb9a72ae7a24242bfab248d767a1ac5dec981c672a3944f7a072375e9aa3d6a6c68c2e759f7c36f35687f6b60d163c2e1a0846a4c07a4c4006a96d88c775f12ea2f30d9c0d872dade345f30f562e6d93847b6a509ba53beec6d0b2c3467bef1324e8a451edd2b747f0d9bda9f6ee440dd4b1979cc75012492a27db710fd6c2d0c5970d87a7434290e69b81bb506193a25f379d8d4d4cf98d05b9b6b222faea6207a7c5b66f1c412423d4b4435691b5f93d78dc3b170af5747e1d37bbb53f1ae0a073cd6b0d8fc36a8d8e31c33c2f80cbf21a0db0aa3f777fe4df9c8f607d61d2146924d7454275d0560accef361a306c6f59f42657563436b92227a0eb48d2b4e361df0767b394341b49544616a23520ce40e00b23535c295777e0b24173dd15d6754f12d6247727bec6fa3e078f15e512ef4a00fc24131f3ed51bb58ce7f4acec435dd7f07f8d5318d6d179515ff2d57bba8db57300f1bca0a7a5b860e6dea439fadd8002d3f8fde882cb3a3c5f64f8b7b27acb9ec9cba4ddd532667258be12a72c26f6d4dac3b88f47acfa5586e0ca43d358245a0e55c1aae0da30d3d18dc15ce690e6d7edbc27ade8b038943e00fcaf6281329f97ec14266becf3805329e3141811cb21eb0d94550265eb5c6d2f0a1240331facc6738edc9a00cd5a6cc81e21e4625f34380c018f575df6f24723c108c78ce594e059e00162d5efc4533e3631cb321d9023ac1e9cc3d13b073d31b1a4dbcf19ccd4f23d0818623ed1a348cdfdec7bc98624f16e5c97299314e5f090530acd6f6aff377d36971ec7b3c652db8d6ac1d35b4a0b4fa195590e2a48923dbccc9a5d9e38fb49fee7029db1ef22d6cd08f5efd127c77a49f15d5c0c30b378b30531df5725794afa2653ab96924dc3c5709be655d3bea9e17f0c7683aabb8b06d49a04f25d409a068a0139494afb103dab1ecc8a233e3bcc9df92ace1f0fd14d2d0a3d1d69ccc5f2e7373503cdaed00817108a628aae259ca0271b8713e3533df481207be33b932f8ef1a4feda89c989d6013c5a5481c5fa2782a3657e629707221cf441f159080f961568bda24c61a83d4d3359d095b4950c236fe8fed8ee0ebcd2c736afeb545bbc0f1f56a8663e1f1d513c29dd955876aecac4b39e3bf42826c51b2b11f9552ebf7c8d505d3dd81557d83c0980e6a8468347ae96e53df1fb714545be3f329c38330bc54b6dae643b279d0ffbbadb07a29ebc6aaa7be9b90bc122e6a65de8491bab40bced3be4ffdbcd7adea90479a5fc6cb82a24bb8e2d8babd79702dbfc6903444435f3043c75064ccd427b6f001e1a972a476d6e54541ce3aad86cd34d0fad42f866a741840869daf90f02f13f3904ae136de6199186f1a15b1a1764c4570a6fe3710dcb781065ba1d6ea3931bf717157b90d8e9d3c1c88896966921c89aa713887c17b78466f397979bbd538b4f8f3b580040c44add5ecd377c75b5c6dcc34fb1192234c338e978cd7557a559e99cd31f02c95280e4ab3a666df14d6480d924bac5931e17fd5bbdd6022b70f5375125f0c86fa6058e62b9e8217ad5a7ddb35320d076d686636df8c01d25db81d852b91e98194f232a86fd2fc36d126058a9c3d32d895c1af46c7300e87a73dacf6cf41ce397e3f05df6bd9c7e227b4ac59f8576916069828c857d4824b9f850b1e0597d2c134c91114b7a0774c41dffe33b0eb237214c416738a0e2fa6ab766ccf1a9b0a80974e733f9615168dd22a069afa7d5b38d5c1af46c7300e87a73dacf6cf41ce397e3f05df6bd9c7e227b4ac59f85769160b3a0d07eca080812716d4a9b76e84e26d975a06d12e327a0442837100b348b734f23d3f887354f612762f18edba81f3513f8cac065ae1a5b4634315ac88ee35ed1edc77552971cbe35e4eee7a7e014aa11055cf3ee0dd24a6c8e3b72143f0c4edcb2edf77f1ee8e47bc163f322f090bbb2c25994882aaa0a57ac37afc8d5de463cca8654f5cf610823513bc483d6c671c440908383ad0e8d9ac0e0fdfc04af02495d2052f5f9fae12c9e30c96024b9211896b3ecc4a8de47fef60972e6aaefe029839deb26d1c63056f0d266603f2dfd4cb2566caca69157a87a452ddb251975991f378be9aef99514ffb4da3206027914b2ce4aaff25a09fc647dc614b60c3c454cd0cc2414697b7074bb581d661b21098e6844b906baaad45bd403fb6efb925864ede6989eccedbb73e0dbc7a9794384f715fdb4039cfbf3bda1bf7680858668e385a38246c00b2206db46603b2a152ed8a9641e6768fa0d6882b9c�x�������������������X�
Sp�?up s���������q�������4Many�$o����������������
�4�45
�-id/00//usr/lib/.build-id/05//usr/lib/.build-id/06//usr/lib/.build-id/0b//usr/lib/.build-id/0c//usr/lib/.build-id/0d//usr/lib/.build-id/0f//usr/lib/.build-id/10//usr/lib/.build-id/12//usr/lib/.build-id/17//usr/lib/.build-id/19//usr/lib/.build-id/1b//usr/lib/.build-id/1c//usr/lib/.build-id/20//usr/lib/.build-id/21//usr/lib/.build-id/24//usr/lib/.build-id/29//usr/lib/.build-id/2c//usr/lib/.build-id/34//usr/lib/.build-id/38//usr/lib/.build-id/39//usr/lib/.build-id/3b//usr/lib/.build-id/3c//usr/lib/.build-id/3d//usr/lib/.build-id/42//usr/lib/.build-id/4d//usr/lib/.build-id/50//usr/lib/.build-id/51//usr/lib/.build-id/55//usr/lib/.build-id/59//usr/lib/.build-id/5a//usr/lib/.build-id/61//usr/lib/.build-id/64//usr/lib/.build-id/66//usr/lib/.build-id/67//usr/lib/.build-id/7c//usr/lib/.build-id/80//usr/lib/.build-id/83//usr/lib/.build-id/86//usr/lib/.build-id/99//usr/lib/.build-id/9e//usr/lib/.build-id/a2//usr/lib/.build-id/a8//usr/lib/.build-id/ab//usr/lib/.build-id/b1//usr/lib/.build-id/b7//usr/lib/.build-id/ba//usr/lib/.build-id/bb//usr/lib/.build-id/c6//usr/lib/.build-id/c9//usr/lib/.build-id/cb//usr/lib/.build-id/d0//usr/lib/.build-id/d1//usr/lib/.build-id/d4//usr/lib/.build-id/d5//usr/lib/.build-id/d7//usr/lib/.build-id/db//usr/lib/.build-id/e0//usr/lib/.build-id/e1//usr/lib/.build-id/e2//usr/lib/.build-id/e3//usr/lib/.build-id/e6//usr/lib/.build-id/eb//usr/lib/.build-id/ed//usr/lib/.build-id/ef//usr/lib/.build-id/f0//usr/lib/.build-id/f2//usr/lib/.build-id/f3//usr/lib/.build-id/f8//usr/lib/.build-id/f9//usr/lib/.build-id/fa//usr/lib/.build-id/fb//usr/lib/.build-id/fe//usr/lib/systemd/system//usr/lib/tmpfiles.d//usr/lib64/mysql//usr/lib64/mysql/mecab//usr/lib64/mysql/mecab/etc//usr/lib64/mysql/plugin//usr/lib64/mysql/plugin/debug//usr/sbin//usr/share/doc//usr/share/doc/Percona-Server-server-57//usr/share/man/man1//usr/share/man/man8//usr/share/percona-server//usr/share/percona-server/bulgarian//usr/share/percona-server/charsets//usr/share/percona-server/czech//usr/share/percona-server/danish//usr/share/percona-server/dutch//usr/share/percona-server/english//usr/share/percona-server/estonian//usr/share/percona-server/french//usr/share/percona-server/german//usr/share/percona-server/greek//usr/share/percona-server/hungarian//usr/share/percona-server/italian//usr/share/percona-server/japanese//usr/share/percona-server/korean//usr/share/percona-server/norwegian-ny//usr/share/percona-server/norwegian//usr/share/percona-server/polish//usr/share/percona-server/portuguese//usr/share/percona-server/romanian//usr/share/percona-server/russian//usr/share/percona-server/serbian//usr/share/percona-server/slovak//usr/share/percona-server/spanish//usr/share/percona-server/swedish//usr/share/percona-server/ukrainian//var/lib//var/run/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x������������������X�
�?Q��������������4Q�$f����������������
�4�4�4
�laudd <mvensson@mysql.com>Alexander Nozdrin <alexander.nozdrin@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Joerg Bruehe <joerg.bruehe@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Jonathan Perkin <jperkin@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent.boortz@sun.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Timothy Smith <tim@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Daniel Fischer <df@mysql.com>Daniel Fischer <df@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Jim Winstead <jimw@mysql.com>Jim Winstead <jimw@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Joerg Bruehe <joerg@mysql.com>Kent Boortz <kent@mysql.com>Kristian Nielsen <knielsen@mysql.com>Kent Boortz <kent@mysql.com>Rodrigo Novo <rodrigo@mysql.com>Joerg Bruehe <joerg@mysql.com>Joerg Bruehe <joerg@mysql.com>Lenz Grimmer <lenz@grimmer.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Kent Boortz <kent@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Joerg Bruehe <joerg@mysql.com>Guilhem Bichot <guilhem@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Petr Chardin <petr@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Petr Chardin <petr@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>MontyMontyMontyTim Smith <tim@mysql.com>David Axmark <davida@mysql.com>David Axmark <davida@mysql.com>David Axmark <davida@mysql.com>David Axmark <david@detron.se>David Axmark <david@detron.se>David Axmark <david@detron.se>- Added RocksDB- fix license field- Provide my.cnf for all systems- Include mysql-keyring directory
- Provide keyring_file.so plugin- Fix for centos6 to write temp pass into log file instead of stdout (#1541769)- Re-added TokuBackup to the packaging (JEN-439)- Initial release PS 5.7.10-1rc1- Updated for 5.7.9
- Added libtest_* plugins to test package subpackage
- Add mysqlpump man page
- Obsolete mysql-connector-c-shared dependencies- Add support for pkg-config- Added libtest_framework.so, libtest_services.so, libtest_services_threaded.so plugins
- Build and ship mecab plugin- Include boost sources
- Fix cmake buildrequires
- Fix build on el5 with gcc44
- Add license info in each subpackage
- Soname bump, more compat packages
- Updated default shell for mysql user
- Added mysql_ssl_rsa_setup
- Include mysql-files directory- Provide replication_observers_example_plugin.so plugin- Updated for 5.7.6- Provide mysql_no_login.so plugin- Provide mysql-compat-server dependencies- Remove perl(GD) and dtrace dependencies- Resolve embedded-devel conflict issue- Add bench package
- Enabl�x�������������������X�
�	?�x�����5�$
����������������
555
�842ec009edf89703e93ed1afef85f8b6fd4bafe52751ef072e8e57149cfc8a74dc38e4e2bbfb313618076fa57094652594e21f34d2de546e9339fe30968466451084015eeae971bcd7bb9cda01bd4cf2f83581b35b6fd6e558ee617a39aba2bfb69f8ff02ee615ad3caac1496e63d3a69cc8f8b8aea23b407e5df284dc7cae750a60ddc408154255c0d6b330aea62b615c0cdc31d477fab1a4fa337f3a2ea2a6bd83db6cd42cebe6a6877c5c5b9f1ae27a93ea970006c691ec27c81e56c96ebdbf90c9152452ffcab6234f1e9255652708f4ed7b464122cb0d06f9672c08d843279cb71d76d7f90892f1e3894cb531cfc45c0c9a4c623c5e60a29077035c30bdbf174bed021faa9ca4d87be0a94f141efb88b589cbf28c468b8692356babd261bc0c03fbac2eb2ba16bf33024ef31c3472b28684ffaac3810202c19bd18aaa906b345fe6ac45de197404f9a1ff457d9c1a08dc4150a7f202bbfb211f5f9306a865d1002eb0a08f0c53a580715e3785e8c16b2f09681b43c9026b48d61157232a6c0fde64584f717d1e617ff6b6bf5570eec9299762eba82c47efd151752bf6e7a3b2c937ae64c7ad054959e340dac57e5526a8aa59a31ec9f0d01a3e60ece42fda9e2c1f3c3c73be992b08aa9fc27746f3b984df546fe9be7002426a309c407c9036caa970309b3cf0e5133043c1a04c735e8dfe93b799d5ffbce401106b2a88c85c8b607a3be87a054954a51b8406b922876b70bb5da6bc9132635e4762ff0ad48ea6b249cf19f58cfb53a4086d77f333271e8a6b30279cc1de084b6c03668c1cf41fcea5a065163258265e313b1bedbb05566891f8a28806e8128594b82650fb37c9aade112bc7ed1f2be0fc693614dce8d5bf19275c386d2073a46cc6c0947f08bdb243a005230590912d6f6cf3f0d975dfc20a18a0bae0c4d55081f95ce47586bda9382ce9dfd45c73291d98602fa9158a02e54eeffeab42e62fc15d24aabe523ec04ffa30ad0f93f457f26ab9212b950334201b81a04b5e76fdcaa61abfcecf63085ec09a97ec5fb22b3b7c0ee7994de3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855284b32ad114e06cda3851f80723c89c9e5791a5b0ad6e6d0a800758fe6f466ee46703c52042a670b418c176a8b50d6d60237c5a67baa12a9d5777ed184e4b529863009ef988ab897ca41800b643d14eb027b12527f04012f8c3c45f1bf7f979900ef579d31a14e01ed66653c0e46dfa35386af8d6b06e4838c88006b8cd42a014d511363e2ff33f75210a0614c871038fef9cca557c3cb6eab5537e78326df406853153afc86fbf08022e5c4571b8f264cf951f0a9a527aef4504fce7dad5af271ae0ef4290fb7d126f6c2c27f71f4895b75188716eccf02d14e57a28681b93e662630e46954a4b571e15247cf84b500fd8914dcaf1f48aae64a5c623da8bf2c997ee1c83d863413b69851a8903437d2bfc65efed8fcf2ddb71714bf5e387beb278542387be4fc1800ff01b4d969a50ed4962f0649e52fe0f525c19236288dac60aad9bc7f3de08a9fda812462a17d3bb08ad438d381f6423f747d033a637aaa42e43209913e5e3b898c36118b1a38d2852ddae70584d992ac26dc5d8ec0f5a10e0fa5158b058587a26fc36e42f18ec5dd30c5c993a977defdce7361bddea7ae62073295e4e0cae87b370187f63f3fdb586daa717f57180a88f73879c2c158a903b994bd3d4a01c0983f71fb814393c761913258280eeaf71faf10d0e26a33901555a459e1adddf2b40d30b71aeaddda3825a7f675d022be69b77ac8cdc70fe0e4df0e4e8b8f0a87fedf4e52b42d982bd1c1c50330fb13b8eac911a013db919a37cc6886f63a088695b7a0f5b14f555afda6b8ef683e38b12038aca815d4af419076222ef90a471db559a2d3c0e23ee78360d124b3659f5213b143d0fb1fbd808caec90eef96b7bdd7fa0aa8ceb16d8095655259d0a343f8210e31e3f80f95f351ff0ac7e3e0a1022e745abd63bb053febb3fc8eb1d6011f3e9249c6e8ce7f5ee3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855aa59a1df6e520557ef1ba31ef6073936c879b1dc07070cc706ae9a117b4ab0b0e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b85516bedb7d368aa97a1a21f4ad7bb9af1512cc6fca406a2a338327681de2328872e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855bb53b87e4bc23b89a19aee62df6c6b0eff405f936051c8bf7985720434214c83e6aeba27dd00a0c28ac32d47b1d5ef11e95e3891bc42401ba3c3a27457a479ed1a78d791a5916df8ddb5025c8dc9a45d4c8f2208dc9021d3bbac249de0cc724f86f2f71e86bd55a628faa10e664062d88ab0db9d540f13f3fae30755a5a62e911d4307be4534d35aed96abecd7534f98cb65c8c30b95541f025eaa5ddb0bc594dd955562bb393eabcb1499062dcb97a0c2b9993227173977d718d4a430696599a5cb27c33eedc720cd65410e58939911f8afcb708e5873dffc3214edfc19f8a96e4acc66cfe32473ff28501b837ebe95c378526b3b11282596ea7ca621d73b3d9d52d27349e5e0967d548ec6b19bdb944fb3cd3f93e687e6320a659de77cb3fbe3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855fa31cb384fd31da673e4115c0a7a122fd11802d2749d77a6e3db3da1f�x������������������X�
exZ?0@d��������xq������i�R@ca�$y����������������
i�h�j�
�ng man pages (phar, php-cgi)
- add provides php(pdo-abi) for consistency with php(api) and php(zend-abi)
- use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113
- add missing ASL 1.0 license- run tests during build- rebase to 5.4.16
- fix hang in FindTishriMolad(), #965144
- patch for upstream Bug #64915 error_log ignored when daemonize=0
- patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103
- patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo)
- fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14
- clean old deprecated options- update to 5.4.13
- security fixes for CVE-2013-1635 and CVE-2013-1643
- make php-mysql package optional (and disabled)
- make ZTS build optional (and disabled)
- always try to load mod_php (apache warning is usefull)
- Hardened build (links with -z now option)
- Remove %config from /etc/rpm/macros.php- update to 5.4.11
- fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10
- remove patches merged upstream
- drop "Configure Command" from phpinfo output
- prevent php_config.h changes across (otherwise identical)
  rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir
- improve system libzip patch to use pkg-config
- use _httpd_contentdir macro and fix php.gif path
- switch back to upstream generated scanner/parser
- use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses
- missing provides xmlreader and xmlwriter
- change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5
- make php-recode optionnal, not available on RHEL-5
- disable t1lib on RHEL-5- enable tidy on RHEL-6 only
- re-enable unit tests- minor macro fixes for RHEL-5 build
- update autotools workaround for RHEL-5
- use readline when libedit not available (RHEL-5)- update to 5.4.8
- define both session.save_handler and session.save_path
- fix possible segfault in libxml (#828526)
- use SKIP_ONLINE_TEST during make test
- php-devel requires pcre-devel and php-cli (instead of php)
- provides php-phar
- update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed
- php-cli: provides cli command in standard root (scl)- add configtest option to init script
- test configuration before service reload
- fix php-fpm service relocation
- fix php-fpm config relocation
- drop embdded subpackage for scl- missing requires on scl-runtime
- relocate /var/lib/session
- fix php-devel requires
- rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp
- php-fpm: new systemd macros (#850268)
- php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085
- no odbc call during timeout, https://bugs.php.net/63171
- check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini
  move it to apache and php-fpm configuration files- update to 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386)
- use /us�x�������������x�����X�
ut�?optiPP�������������]�ons �$M����������������
]�^�\�
�3-6David Malcolm <dmalcolm@redhat.com> - 2.7.3-5David Malcolm <dmalcolm@redhat.com> - 2.7.3-4David Malcolm <dmalcolm@redhat.com> - 2.7.3-3David Malcolm <dmalcolm@redhat.com> - 2.7.3-2David Malcolm <dmalcolm@redhat.com> - 2.7.3-1Thomas Spura <tomspur@fedoraproject.org> - 2.7.2-20Toshio Kuratomi <toshio@fedoraproject.org> - 2.7.2-19Ville Skyttä <ville.skytta@iki.fi> - 2.7.2-18Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.7.2-17David Malcolm <dmalcolm@redhat.com> - 2.7.2-16David Malcolm <dmalcolm@redhat.com> - 2.7.2-15David Malcolm <dmalcolm@redhat.com> - 2.7.2-14David Malcolm <dmalcolm@redhat.com> - 2.7.2-13David Malcolm <dmalcolm@redhat.com> - 2.7.2-12David Malcolm <dmalcolm@redhat.com> - 2.7.2-11David Malcolm <dmalcolm@redhat.com> - 2.7.2-10David Malcolm <dmalcolm@redhat.com> - 2.7.2-9David Malcolm <dmalcolm@redhat.com> - 2.7.2-8David Malcolm <dmalcolm@redhat.com> - 2.7.2-7David Malcolm <dmalcolm@redhat.com> - 2.7.2-6David Malcolm <dmalcolm@redhat.com> - 2.7.2-5David Malcolm <dmalcolm@redhat.com> - 2.7.2-4David Malcolm <dmalcolm@redhat.com> - 2.7.2-3Dan Horák <dan[at]danny.cz> - 2.7.2-2David Malcolm <dmalcolm@redhat.com> - 2.7.2-1Dennis Gilmore <dennis@ausil.us> - 2.7.1-9Peter Robinson <pbrobinson@gmail.com> - 2.7.1-8David Malcolm <dmalcolm@redhat.com> - 2.7.1-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.7.1-6Toshio Kuratomi <toshio@fedoraproject.org> - 2.7.1-5David Malcolm <dmalcolm@redhat.com> - 2.7.1-4Thomas Spura <tomspur@fedoraproject.org> - 2.7.1-3David Malcolm <dmalcolm@redhat.com> - 2.7.1-2David Malcolm <dmalcolm@redhat.com> - 2.7.1-1jkeating - 2.7-13David Malcolm <dmalcolm@redhat.com> - 2.7-12David Malcolm <dmalcolm@redhat.com> - 2.7-11Toshio Kuratomi <toshio@fedoraproject.org> - 2.7-10David Malcolm <dmalcolm@redhat.com> - 2.7-9David Malcolm <dmalcolm@redhat.com> - 2.7-8David Malcolm <dmalcolm@redhat.com> - 2.7-7David Malcolm <dmalcolm@redhat.com> - 2.7-6David Malcolm <dmalcolm@redhat.com> - 2.7-5David Malcolm <dmalcolm@redhat.com> - 2.7-4David Malcolm <dmalcolm@redhat.com> - 2.7-3David Malcolm <dmalcolm@redhat.com> - 2.7-2David Malcolm <dmalcolm@redhat.com> - 2.7-1David Malcolm <dmalcolm@redhat.com> - 2.7-0.1.rc2David Malcolm <dmalcolm@redhat.com> - 2.7-0.1.rc1David Malcolm <dmalcolm@redhat.com> - 2.6.5-17David Malcolm <dmalcolm@redhat.com> - 2.6.5-16David Malcolm <dmalcolm@redhat.com> - 2.6.5-15Dan Horák <dan[at]danny.cz> - 2.6.5-14David Malcolm <dmalcolm@redhat.com> - 2.6.5-13David Malcolm <dmalcolm@redhat.com> - 2.6.5-12David Malcolm <dmalcolm@redhat.com> - 2.6.5-11David Malcolm <dmalcolm@redhat.com> - 2.6.5-10David Malcolm <dmalcolm@redhat.com> - 2.6.5-9David Malcolm <dmalcolm@redhat.com> - 2.6.5-8David Malcolm <dmalcolm@redhat.com> - 2.6.5-7David Malcolm <dmalcolm@redhat.com> - 2.6.5-6David Malcolm <dmalcolm@redhat.com> - 2.6.5-5David Malcolm <dmalcolm@redhat.com> - 2.6.5-4David Malcolm <dmalcolm@redhat.com> - 2.6.5-3David Malcolm <dmalcolm@redhat.com> - 2.6.5-2David Malcolm <dmalcolm@redhat.com> - 2.6.5-1David Malcolm <dmalcolm@redhat.com> - 2.6.4-23David Malcolm <dmalcolm@redhat.com> - 2.6.4-22Marcela Mašláňová <mmaslano@redhat.com> - 2.6.4-21David Malcolm <dmalcolm@redhat.com> - 2.6.4-20David Malcolm <dmalcolm@redhat.com> - 2.6.4-19David Malcolm <dmalcolm@redhat.com> - 2.6.4-18David Malcolm <dmalcolm@redhat.com> - 2.6.4-17David Malcolm <dmalcolm@redhat.com> - 2.6.4-16David Malcolm <dmalcolm@redhat.com> - 2.6.4-15David Malcolm <dmalcolm@redhat.com> - 2.6.4-14David Malcolm <dmalcolm@redhat.com> - 2.6.4-13David Malcolm <dmalcolm@redhat.com> - 2.6.4-12David Malcolm <dmalcolm@redhat.com> - 2.6.4-11David Malcolm <dmalcolm@redhat.com> - 2.6.4-10David Malcolm <dmalcolm@redhat.com> - 2.6.4-9David Malcolm <dmalcolm@redhat.com> - 2.6.4-8David Malcolm <dmalcolm@redhat.com> - 2.6.4-7David Malcolm <dmalcolm@redhat.com> - 2.6.4-6David Malcolm <dmalcolm@redhat.com> - 2.6.4-5David Malcolm <dmalcolm@redhat.com> - 2.6.4-4David Malcolm <dmalcolm@redhat.com> - 2.6.4-�x������������������X�
i@g?raprP.���Pk��������1Re�${����������������
����
�S
z�?
uLd
�
�
�
�	%
�	A
�
X
�
\
�
�
�
�
�
�
�
�
�
�
�	
�
�
�
�
�
�
�
�
y
�
�� �	B�
d�	��+y�
,,�.p�1m�4j
4��6�7`&7�&:�&(;=
);D
*;�
+;�
,;�
-;�
8;�
L9@�
L:w
L=
J�
>
J�
@
J�
D
J�
G
J��H
M�I
O`�X
P`Y
Pt\
P��]
R��^
^�Lb
g�
d
h�
e
i

f
i
l
i
t
i �u
kd�v
m�
w
oX�x
q��y
s�G�
t�
�
u
�
u
�
uH



u\


u`6

w�

w�6


y�


z
�
zH


zL�
z�
g
z�
h
z�
Csetroubleshoot-server3.3.266.el8SELinux troubleshoot serverProvides tools to help diagnose SELinux problems. When AVC messages
are generated an alert can be generated that will give information
about the problem and help track its resolution. Alerts can be configured
to user preference. The same tools can be run on existing log files.e^:8ord1-prod-x86build004.svc.aws.rockylinux.org"xKojiRockyGPLv2+infrastructure@rockylinux.orgUnspecifiedhttps://gitlab.com/setroubleshoot/frameworklinuxx86_64getent passwd setroubleshoot >/dev/null || useradd -r -U -s /sbin/nologin -d /var/lib/setroubleshoot setroubleshoot/sbin/service auditd reload >/dev/null 2>&1 || :/sbin/service auditd reload >/dev/null 2>&1 || :��
m���mmqq��X�X�m�m�1t1t-�-�
�
���qIqI��d-d-��pVpVf�f�@�@�'�'�lh���;�S.
�
�C����4���}�B?P�:R
a{��?FR
����?_5�:D�0�.�.�0��"�0dR4
4�/��<�|:]G-I/�9C5noI�;u��g3�@�9�5�)�0�9T=/�b�2~CCA��3�@J1-�
�}
2b�����������A큤AɁ�A�A�A큤����A큤������������������������������������������������������������������������������������������������������������큤����A큤����������������������������������������������������������������������������������������������������������������������������A���A�����e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:6e^:6e^:6e^:5e^:5`>h�`>h�e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6e^:6`>h�`n��`n��`>h�e^:/`>h�`>h�`>h�`>h�`>h�e^:/`>h�`>h�e^:/`>h�`>h�e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:6`>h�`>h�`>h�`>h�`w6�`>h�e^:/e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:4e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5e^:5af1aba7aef639bbd2d495b259f94e728436c796fb3f4803aa73183aecd3791fa5e8475ddfdc8cf232617c9e17273bc133051d4a1a0605ba089a25b6c319f21a3aefa5f448d04e189719024d7726937038f9a1bef0b30882a916be4b49a8aa092d4b663605dadf69c7deab87532851962853754ecee5c9e490b77511315d12375f�x�������������hw����X�
.3?1
- ������p��������V- a�$-����������������
�V�V�V
�5cfdac75492e517b083af551850b3b4bb1de9e27a1690c14ae9f442dbc1742a738e44ecb2566ee5f41832c5ba19f351d040f3a6823af8deef28df7bc0fca08e596ab197502f04392484de5d90962bfe4183faba8fec1e872140d03ffefc0d9613cc69efa3db126c4ce3e35f25e909fd024117b6b4060eadb00e8a2e1347479a910d2da18aa09a53e992802106f415d349f40e691d0d32de7b2afeb24d94dbd5190dac1381f3b85ce1cc0a997e19eda0bb58a0605fe38caa29e2842902a07adab76a7430462daec6442e405f2dbb76b3d1beff1fdc58317420bf146cd089136f7765da7dcd74820dec46ca5ce468a64be29898c2d7b191993cb260bed9d9d3e495828f91bd47426cce2aa4a42a7655570deea3591578f169f3ad1b3a84216e73c5279044c72002c9f3ebc7b3b79364e496294272172843f19c425d4f0d4425ed26ed62f7f6d8d8cc054bd759b7f25eb7c2b0aac2ae32ae0d62290b60ffb32d3c8465756b7563579ef57542f9c9747b17925f5c05c05122db91abc87c1cdbe1dcaeb46b7e9fb862124de6b833fa15da0a17a4259676593285bd612b99ee4a0ce181af768d23d464ed48f4927acbea778980543856cc9b1f89877f96e59f44427be04f8baa9cf8860fcde3d101410bb61d95f1d37df998d68db3be074717ddf8dbfda1e911efb80cf22ebad64e30c74766c0da24a084b1261056b85f774170fc1526e8a909a1e2952423dae3891b721abc293a27dc450818dcc6dd8469bc1c9375625b62c93847e6e1505598d825bb29d176a5a5f028f0e6a45d08d39211d4948fe77c483d45f953ea983c0e11c120ababe634fdc696300106fa21f5937d4c1735e2f87b1fc722378f29deeffc4cc9767d7c9e42d2f707e8bf79b3894eee02955f0c3253d1ce1303035f8e5e342be81660c2044215cebe6d8e93269997f35044955d76a14361f4751a5aca361d3edca6ba2007368ee7c7e8c024ffd2b2cdc34380430800d52917ef508bd03dd9c1a8ba60375b5413801e20f38ac8526ca756290d468e390f0c3b8b06c56068c1ea71c7d0f44bffd95a2efb66a432410b73208fdb5addbf85c6f245207c07b1e4f0f0d3771c7a297413205f93161a49eb0ebdcd564a3050bd0df6158f8586791e1ba9a2fc63ff8109e8b9b6a492f7f1a36f508f43c9f5613e0b167f4cebec3e6efba4c24e09eff2473fa7261f1d24734b8dec0ae60fb4922fff38ff1f31c0d854eb685e26645130db17153e36c48b0ccc40066ba04bba9afd68a002ace2b1adedde2f16caa044b7b5b1d2c167b26e7567e5fc5892eb1c23b82d3bcfc2a1e2c8eb6e499bac24e641ff300a066cbe3a8e49f04133afdbbcf18b1039f9b9fdd912729ce5d6dc89eacecde2a8263a82cce07fdaefbf422068d81ad11db84e97e5293e623815707b1bff37ee5089a38f8d139cbf6038f8b03e870727a101aa89a7891bc745e92aaf15ba0bbb6007c084c82a6c5dd6b6a0804efa2fc0f301705d86742198db6773fe5df926c2e53cff3dd6495c2b7886aec625d3a16ed176cff45f0559b70a15826f4caf445cfef786228cd7b8343937d98653b3a2f698fcc5dc3aff3a6b523d2cce5307d6eead5006602808e2a1f26cbfd2e26830f26179365312d0a167bfc11365cd553c8670718279d5f6f6459d14cdd4693f908f83dedf713d6e200d2f2334919abb473897b8f5ab1c1e33917c5669b65694002cb9359ae03841f8900c071e577e2d0739510fc4b1d93d14f0452e1c3fa0a6876a21866abeba525f550bda7f025339670eb9e4daf301e64f5acf2cf8db9eacd451e5bb30e48046ba237be972664a7ae1da0930e7bde62609d73ddf830146249bf4ee97b8c3c419ac88be20369e16145f9bb5f952b42c1e33917c5669b65694002cb9359ae03841f8900c071e577e2d0739510fc4b1d93d14f0452e1c3fa0a6876a21866abeba525f550bda7f025339670eb9e4daf301e64f5acf2cf8db9eacd451e5bb30e48046ba237be972664a7ae1da0930e7bde2078a27b08b367a461e32e293d4acb768e567b5efca70bb324fa49503fda8d7d5f8fb54b0694cfe66f1c810cd60833890cbcf2ea3e5d1e370edd3ef58f04fbefa1fea709a190fb62d544b30db9273c52a7107b9a27c53f210087521fe9150e3b0fa3553aac78e43d5a75220208aca267c6dc236a58a6ec308e80492f306fe5ae27ff93da0daaed8f90bc66104c4818245898c69803d5b62f14d0640d9a4d3384213d3dbc2e230e02192d6a093eaa8f7a5319cf266d0058f20c1f5266275b1542ba859b4e92fa139bed3b05e47902e5db6033cb4498e920b194303f808b289e4aef5e9950905426e9e3d94f0c3a784872fde40155e03c60f61d9b16897ab1528613523b0ae3cd1763907f4d4d506b3bb8f3a2d277e8cbfb317593624f7eb4c10f36f5d2a38700a8cecb130ad57f820372913c3ec0ee55f92a5c9dfee051ee75bd86cf57c9d092f86ddd70a98affa0e51af5997bb04423169a89ac1d2b15a8546a523b2630f1c009dc53514527d6028063188d6612a0ca9677113017d5ef4828ea120cb16dcf9180468912bc8defba090f4d16faa4d8d82d9ff1a20c293420a95e977f35b76c91e520e520c7374176c7b785a976a9d840999f801d5cc69a96c5510be3834ece2f2cbf9acc8ec18b668fa3a2406a05c806d9f917f84c78e78c310bdffa3d745de36b9a9e21be43d6449c66cc501c6dfb00cf9dae272aff38fe2d0f2e1bb35ca2a9f6ab3e9064499b9e0a4a618e9a4eaa23f624157e8293281a8f66fb8becde635b68453e56e7e79c7e61a5b6468839c736f�x��������������f����X�
7e�?50a(������������hee7e�$s����������������
�h�h�h
�hio Kuratomi <toshio@fedoraproject.org> - 0.7.7-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.7.2-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.36-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.28-4David Malcolm <dmalcolm@redhat.com> - 0.6.28-3David Malcolm <dmalcolm@redhat.com> - 0.6.28-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.28-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.27-3Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.27-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.27-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.24-2Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.24-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.24-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.21-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.19-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.14-7Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.14-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.14-5Thomas Spura <tomspur@fedoraproject.org> - 0.6.14-4Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.14-3Thomas Spura <tomspur@fedoraproject.org> - 0.6.14-2Thomas Spura <tomspur@fedoraproject.org> - 0.6.14-1David Malcolm <dmalcolm@redhat.com> - 0.6.13-7David Malcolm <dmalcolm@redhat.com> - 0.6.13-6Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.13-5Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.13-4Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.13-3Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.13-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.13-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.10-3Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.10-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.10-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.9-4David Malcolm <dmalcolm@redhat.com> - 0.6.9-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.9-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.8-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.8-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.7-2Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.7-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.6-1Toshio Kuratomi <toshio@fedoraproject.org> - 0.6.4-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6c9-5Konstantin Ryabitsev <icon@fedoraproject.org> - 0.6c9-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6c9-3- Security fix for CVE-2025-47273
Resolves: RHEL-96802- Security fix for CVE-2024-6345
Resolves: RHEL-50470- Security fix for CVE-2022-40897
Resolves: rhbz#2158559- Create /usr/local/lib/pythonX.Y when needed
Resolves: rhbz#1808301- Add subpackages with wheels
Resolves: rhbz#1718032- New subpackage platform-python-setuptools without files from /usr/bin/*
- python3-setuptools contains only files from /usr/bin/* and depends
  on platform-python-setuptools
- Resolves: rhbz#1641973- Allow Python 2 for build
  see https://hurl.corp.redhat.com/rhel8-py2- Do not use wheel on Python 2- update to 39.2.0 Fixes bug #1572889- Remove test requirements on python2 packages and some exotic packages
- Skip tests on Python 2- update to 39.0.1 Fixes bug #1531527- Skip test_virtualenv due to broken executable detection- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Update conditional- update to 38.4.0 Fixes bug #1531527- update to 38.2.5 Fixes bug #1528968- Update to 37.0.0 (fixes #1474126)
- Removed not needed pip3 patch (upstream included different version of fix)- Update to 36.5.0 (related to #1474126)- Remove the platform-python subpackage- Re-enable tests to finish bootstrapping the platform-python stack
  (https://fedoraproject.org/wiki/Changes/Platform_Python_Stack)- Add the platform-python subpackage
- Disable tests so platform-python stack can be bootstrapped
  (https://fedoraproject.org/wiki/Changes/Platform_Python_Stack)- Add Patch 0 that fixes a test suite failure on Python 3 in absence of
  the Python 2 version of pip
- Move docs to their proper place- Switch macros to bcond's a�x�������������XV����X�
L?����p������Xp���ɞ�$Y����������������
ɞȞʞ
� (BUG 3860)- do not link statically on IA64/AMD64 as these systems do not have
  a patched glibc installed- Added libmygcc.a to the devel subpackage (required to link applications
  against the the embedded server libmysqld.a) (BUG 4921)- Added EXCEPTIONS-CLIENT to the "devel" package- disabled OpenSSL in the Max binaries again (the RPM packages were the
  only exception to this anyway) (BUG 1043)- fixed server postinstall (mysql_install_db was called with the wrong
  parameter)- added mysql_tzinfo_to_sql to the server subpackage
- run "make clean" instead of "make distclean"- added ncurses-devel to the build prerequisites (BUG 3377)- when using gcc, _always_ use CXX=gcc
- replaced Copyright with License field (Copyright is obsolete)- added myisam_ftdump to the Server package- link the mysql client against libreadline instead of libedit (BUG 2289)- marked /etc/logrotate.d/mysql as a config file (BUG 2156)- fixed file permissions (BUG 1672)- made testing for gcc3 a bit more robust- added missing file mysql_create_system_tables to the server subpackage- removed dependency on MySQL-client from the MySQL-devel subpackage
  as it is not really required. (BUG 1610)- Fixed BUG 1162 (removed macro names from the changelog)
- Really fixed BUG 998 (disable the checking for installed but
  unpackaged files)- Fixed BUG 959 (libmysqld not being compiled properly)
- Fixed BUG 998 (RPM build errors): added missing files to the
  distribution (mysql_fix_extensions, mysql_tableinfo, mysqldumpslow,
  mysql_fix_privilege_tables.1), removed "-n" from install section.- removed the GIF Icon (file was not included in the sources anyway)
- removed unused variable shared_lib_version
- do not run automake before building the standard binary
  (should not be necessary)
- add server suffix '-standard' to standard binary (to be in line
  with the binary tarball distributions)
- Use more RPM macros (_exec_prefix, _sbindir, _libdir, _sysconfdir,
  _datadir, _includedir) throughout the spec file.
- allow overriding CC and CXX (required when building with other compilers)- re-enabled RAID again- disabled MyISAM RAID (--with-raid)- it throws an assertion which
  needs to be investigated first.- added missing file mysql_secure_installation to server subpackage
  (BUG 141)- re-added missing pre- and post(un)install scripts to server subpackage
- added config file /etc/my.cnf to the file list (just for completeness)
- make sure to create the datadir with 755 permissions- removed unusedql.com>

- Reworked the build steps a little bit: the Max binary is supposed
  to include OpenSSL, which cannot be linked statically, thus trying
  to statically link against a special glibc is futile anyway
- because of this, it is not required to make yet another build run
  just to compile the shared libs (saves a lot of time)
- updated package description of the Max subpackage
- clean up the BuildRoot directory afterwards- Updated Packager information
- Fixed the build options: the regular package is supposed to
  include InnoDB and linked statically, while the Max package
  should include BDB and SSL support- Use more RPM macros (e.g. infodir, mandir) to make the spec
  file more portable
- reorganized the installation of documentation files: let RPM
  take care of this
- reorganized the file list: actually install man pages along
  with the binaries of the respective subpackage
- do not include libmysqld.a in the devel subpackage as well, if we
  have a special "embedded" subpackage
- reworked the package descriptions- Added embedded server as a separate RPM- Added mysqld-max to the distribution- Added mysql-test to the bench package- Added separate libmysql_r directory; now both a threaded
  and non-threaded library is shipped.- Added the support-files/my-example.cnf to the docs directory.

- Removed devel dependency on base since it is about client
  development.- Cleaned up some for 3.23.- Added support for shared libraries in a separate sub
  package. Original fix by David Fox (dsfox@cogsci.ucsd.edu)

- The --�x��������������E����X�
Re�	?olle��������T���35t.or�$#����������������
352545
�ySQL 5.7- Alter script to acept 5.6 and 5.7 mysql version
- Change hash root password- Reduce lvm size to 50G- Fix trocasenha- Restart uwsgi after install packages- lwmysrvadm to help G2 creation- Fixes to use in G2- Preparing to production- script to help creating a service- Use PATCH- Initial release/bin/sh/bin/shlwdbadminbuild 1731335487































































































































































































































































































































































































































































































































































































































































































































































































































































































































































�x�������������H5����X�
89K?1a2d`�������O���Ȟd0�$X����������������
ȞǞɞ
�IC, position independent code.- Use character set "all" when compiling with Cluster, to make Cluster
  nodes independent on the character set directory, and the problem
  that two RPM sub packages both wants to install this directory.- Use "./libtool --mode=execute" instead of searching for the
  executable in current directory and ".libs".- Install and run "mysql_upgrade"- Remove sql-bench, and MySQL-bench RPM (will be built as an independent
  project from the mysql-bench repository)- Remove old mysqltestmanager and related programs- Set $LDFLAGS from $MYSQL_BUILD_LDFLAGS- Changed product name from "Community Edition" to "Community Server"- Fast mutexes is now disabled by default, but should be
  used in Linux builds.- Reintroduced a max build
- Limited testing of 'debug' and 'max' servers
- Berkeley DB only in 'max'- Use "-i" on "make test-force";
  this is essential for later evaluation of this log file.- Pass '-static' to libtool, link static with our own libraries, dynamic
  with system libraries.  Link with the bundled zlib.- Modified RPM spec to match new 5.1 debug+max combined community packaging.- Added "client/mysqlslap"- Added zlib to the list of (static) libraries installed
- Added check against libtool wierdness (WRT: sql/mysqld || sql/.libs/mysqld)
- Compile MySQL with bundled zlib
- Fixed %packager name to "MySQL Production Engineering Team"- Avoid using the "bundled" zlib on "shared" builds:
  As it is not installed (on the build system), this gives dependency
  problems with "libtool" causing the build to fail.
  (Change was done on Nov 11, but left uncommented.)- Extend the file existence check for "init.d/mysql" on un-install
  to also guard the call to "insserv"/"chkconfig".- added more man pages- Made yaSSL support an option (off by default)- Enabled yaSSL support- Give mode arguments the same way in all places
lenz@mysql.com>

- fixed the removing of the RPM_BUILD_ROOT in the %clean section (the
  $RBR variable did not get expanded, thus leaving old build roots behind)- Fixed the creation of the mysql user group account in the postinstall
  section (BUG 12348)
- Fixed enabling the Archive storage engine in the Max binary- Fixed the Requires: tag for the server RPM (BUG 12233)- create a "mysql" user group and assign the mysql user account to that group
  in the server postinstall section. (BUG 10984)- Do not build statically on i386 by default, only when adding either "--with
  static" or "--define '_with_static 1'" to the RPM build options. Static
  linking really only makes sense when linking against the specially patched
  glibc 2.2.5.- added mysql_client_test to the "bench" subpackage (BUG 10676)
- added the libndbclient static and shared libraries (BUG 10676)- use "mysqldatadir" variable instead of hard-coding the path multiple times
- use the "mysqld_user" variable on all occasions a user name is referenced
- removed (incomplete) Brazilian translations
- removed redundant release tags from the subpackage descriptions- Added a "make clean" between separate calls to "BuildMySQL".- Removed the mysql_tableinfo script made obsolete by the information schema- Enabled the "blackhole" storage engine for the Max RPM- removed the MySQL manual files (html/ps/texi) - they have been removed
  from the MySQL sources and are now available seperately.- old mysqlmanager, mysq* Mon Feb 7 2005 Tomas Ulin <tomas@mysql.com>

- enabled the "Ndbcluster" storage engine for the max binary
- added extra make install in ndb subdir after Max build to get ndb binaries
- added packages for ndbcluster storage engine- replaced obsoleted "BuildPrereq" with "BuildRequires" instead- enabled the "Federated" storage engine for the max binary- ISAM and merge storage engines were purged. As well as appropriate
  tools and manpages (isamchk and isamlog)- enabled the "Archive" storage engine for the max binary
- enabled the "CSV" storage engine for the max binary
- enabled the "Example" storage engine for the max binary- MySQL-Max now requires MySQL-server instead of MySQL�x��������������$����X�
20�	?5betK�6���$5PM c�$4����������������
$5#5%5
�91640b856836166f8d1d0933903524c9d9eb130389c4338575a05d3557b3595601e51ec42d73d7dfa96fae886c187b14ef2b97be8927a5ff7d43b21c7e0aa4da9cd3caeac9f07fdf3890d5a425265fa1fcbffee5575ce27d5d5f731f760abd9d862521ebdf3d509261b7ab9e5a46659a8a9dfcd949f27cd787c835c6bc7227198949418f250fc9a379ca3a2c0194b686cbb8f69fba19a02a09304512ff598f0a27861e0c21e9725bd9303eae5343973788f9cb1b5875c58c60fcb8e62a00b31fc963a14f8f670ba8db3e1eb9d465fe7ee6de51bd95e2f4218a9eb386ec9bc7347f17d9ba269f8cc8053babf63708a69c8fecf89abe37ec93b623125aafc5e60eda7a54c8f3ce7a4711515060dfd7f84c5e78ff2099d57d25c20db2e506b0b254cfd69f314d11b7c78233b0db61a10d26dcab46ddab6e5c4dbfa7e875969b46d284b41a77f9a4278988695a23e55f1251ce9de79ccca1d69d23796b5d3eec831c25a5ee47599d4b77d4017e77137f365384ca8c9d073d7d030a5e5983d260266f38b25237f3dd6ad66e05531e1dbc78b400d86930ebc6a602977f8fba90057e0c4c8fb34ef00afc9e2a0c69a29b83eaca9ea742ecba6307d798e85a287455d6e75e9626f844cd8e818577ac32b1ff7a9363e8af1252d25d8a98048acdc474808a799f1559efe775c9bab767eb03f13cc5b974baa9a85919f1da9a146d6d7fd4e201aa3a53d2c2a042e6a0ed23be5c719837b0022d41679a22ef32dc5477d783b8aebf529b3e07b04ad930ade3baeee2165933445f55f5188f96dba6272918b3f8421c398c1b6fa7d9d9a4e3c30dcfc23301f3e6626c27b83fb07ea86d61335827feb257632c51cfa7cd7fce213448b439cd02fd225635dd1558ad7f77faded1f32bf999d6c231b2e762118e0308778093ea17b7a6e57034ae6a51e36cf56cb87cd28a049730f252f95a28d9edc1cc02434c302c2b67ef8aa2a57d33646d2e8b94e3ea926e20b0bfbd5d0ea27646c80dfaf59635c23b39ee55432f385a47067e9c2b45b3f6020cd9bef40a1f47e30ef6502d8f0c2eba40a9b5ea4e68910a3195b65478b2479854ec70fc22d4790c06251718da48a4edaccf327e4876d0c2ae359d52f675921946e9c9ab346186f4e286ac7f3d966dd996040b18755f73a3db9e55a9ab737a560500acda36aaf7debcaedda9b91543071d476cd897bf6eee3a4f22744ff894f7ffdd53aa8b498c03b3ca1263ab6fa80c89a3345aceb5a4a778414325307eb04935c27504b3b5c3b79202ab028c22d7b5ffc24554a3c05d569b2381c8654635d710f28676d1e06e5c7d2617f2acac75f89ec9971c3f7fbb3c65b3c54228b65163136696d2fec49a1f72d005bda380048df54c843c4acd31561715109f8eaca4548be7a83214661771b4fb976807a5ea0ae342bc721772052f6be3ae943c094408d9cc7637a32b4c0a8aea5f52564ead5b0791d74f0f33c3a5eea3657f257e9c770b86c61ae47d230fe3cd9464c9e989e475fcac1ff0446c642017019b5aa1e78afbce195308413944dc57ae464f071ee123ee4d747c67cab72d811c9adb6a7066f46d8a062b9fe9c6bcba215f31271116c6142ad6f99de30fb712b146d5e7e74ff57f7562bead29919dcc1a0d8b9def06d8aad1427ffd7d390a6c5275026a3966b0e9266d36f74340a87af18a62fe5d5f596cfbe2e7f2d941d3e5043ac8bd070ce567eb38fc69d82c478b5629fddd43f09c56e147aaf5f0bbd6d7a040569a7e1e7c1865d2152a7c8b4dff1d83562851d0c1dd03828231508e3bc568072685a7f6ba303867d7f986f7a9667a67899d881660a75888ddbe25a8cecf2c6c04418566a3c2838560667540b62bddbb41c56fdd110c5b71cc3dc97171c3d09e0c4b4ae517425d5fadb707dda0d2ff00dc110cf6aa517f7f7a00477f85f8e47c35154cabb485c1aabb802de191abcf828ed8c4dad2d0f16dba42772171879d5b31667bc0316784fac935bc122c3a01fe0286e32186cafce12374917fe78525fc3d44884f5733f7208edd741c4e8a30bbb8d378cffe3a1d8523c184c960c3622c9a064e8ae6666de2e13d9375595a28f1cbb13f4657268753286a668f27cada8dd3416a02b18e059377f320dc77faa8e07b4b9d23a7c2d544120cf629306af1792b95f5c638ae653ecb8025e59d289a0b495ffa37a229079fb43daf382b32d4b9c24c1516b3c372bb649fb3a2d19aa42ec789d95b4f06c03b6814c75e77ac189e489a3b64ef282ed2fec1ea722c0173f5d40ef1a92e850ba94501d688ab3c73fc2f9ab7868c720bb3246f3f1b8c4319dfb69b8829e444fb610b43f64c0b0309fa8f227be971759abf1e0d0f706d320c4547d899e3fb775856be35d20ac4ef2fb4e774b70069a7171e617dd486e2b517ec0f9cfe838ff099cb87f916a1c8838d6cf82208e160b730e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8550bbb177df1d35ccdcffa268b3cf7ea7e60e8c4e7e540c24b70cede77da778da90e565af2fe898a15707d0e731e274e03ec43134a2b710214cb156709a5280ca1524364aec672aa2c202c700d0539af3210af68d4af48d621c8ea73fc9739e43675b68272cdbb77237d827316185e6703f06b567e90f8dae329826957dfdf801b208447a4eb099494a0923ab5528781a0c4ea86f369de037d17231be4a7fc125e6fd2a4e4c17b2b18612e07039a2516ba437e2dab561713dd36e8348e83e11d295dc6e25c1faa723bf76dca21a7a37df1332938fe3f8f79be88e03ca6d2b61966cf9c9e1b5ca038fc78b�x�������������8����X�
 n=?pstr����������������	ixes�$G����������������
�	�	 �
�multipart.pycmultipart.pyononmultipart.pynonmultipart.pycnonmultipart.pyotext.pytext.pyctext.pyoparser.pyparser.pycparser.pyoquoprimime.pyquoprimime.pycquoprimime.pyoutils.pyutils.pycutils.pyoencodings__init__.py__init__.pyc__init__.pyoaliases.pyaliases.pycaliases.pyoascii.pyascii.pycascii.pyobase64_codec.pybase64_codec.pycbase64_codec.pyobig5.pybig5.pycbig5.pyobig5hkscs.pybig5hkscs.pycbig5hkscs.pyobz2_codec.pybz2_codec.pycbz2_codec.pyocharmap.pycharmap.pyccharmap.pyocp037.pycp037.pyccp037.pyocp1006.pycp1006.pyccp1006.pyocp1026.pycp1026.pyccp1026.pyocp1140.pycp1140.pyccp1140.pyocp1250.pycp1250.pyccp1250.pyocp1251.pycp1251.pyccp1251.pyocp1252.pycp1252.pyccp1252.pyocp1253.pycp1253.pyccp1253.pyocp1254.pycp1254.pyccp1254.pyocp1255.pycp1255.pyccp1255.pyocp1256.pycp1256.pyccp1256.pyocp1257.pycp1257.pyccp1257.pyocp1258.pycp1258.pyccp1258.pyocp424.pycp424.pyccp424.pyocp437.pycp437.pyccp437.pyocp500.pycp500.pyccp500.pyocp720.pycp720.pyccp720.pyocp737.pycp737.pyccp737.pyocp775.pycp775.pyccp775.pyocp850.pycp850.pyccp850.pyocp852.pycp852.pyccp852.pyocp855.pycp855.pyccp855.pyocp856.pycp856.pyccp856.pyocp857.pycp857.pyccp857.pyocp858.pycp858.pyccp858.pyocp860.pycp860.pyccp860.pyocp861.pycp861.pyccp861.pyocp862.pycp862.pyccp862.pyocp863.pycp863.pyccp863.pyocp864.pycp864.pyccp864.pyocp865.pycp865.pyccp865.pyocp866.pycp866.pyccp866.pyocp869.pycp869.pyccp869.pyocp874.pycp874.pyccp874.pyocp875.pycp875.pyccp875.pyocp932.pycp932.pyccp932.pyocp949.pycp949.pyccp949.pyocp950.pycp950.pyccp950.pyoeuc_jis_2004.pyeuc_jis_2004.pyceuc_jis_2004.pyoeuc_jisx0213.pyeuc_jisx0213.pyceuc_jisx0213.pyoeuc_jp.pyeuc_jp.pyceuc_jp.pyoeuc_kr.pyeuc_kr.pyceuc_kr.pyogb18030.pygb18030.pycgb18030.pyogb2312.pygb2312.pycgb2312.pyogbk.pygbk.pycgbk.pyohex_codec.pyhex_codec.pychex_codec.pyohp_roman8.pyhp_roman8.pychp_roman8.pyohz.pyhz.pychz.pyoidna.pyidna.pycidna.pyoiso2022_jp.pyiso2022_jp.pyciso2022_jp.pyoiso2022_jp_1.pyiso2022_jp_1.pyciso2022_jp_1.pyoiso2022_jp_2.pyiso2022_jp_2.pyciso2022_jp_2.pyoiso2022_jp_2004.pyiso2022_jp_2004.pyciso2022_jp_2004.pyoiso2022_jp_3.pyiso2022_jp_3.pyciso2022_jp_3.pyoiso2022_jp_ext.pyiso2022_jp_ext.pyciso2022_jp_ext.pyoiso2022_kr.pyiso2022_kr.pyciso2022_kr.pyoiso8859_1.pyiso8859_1.pyciso8859_1.pyoiso8859_10.pyiso8859_10.pyciso8859_10.pyoiso8859_11.pyiso8859_11.pyciso8859_11.pyoiso8859_13.pyiso8859_13.pyciso8859_13.pyoiso8859_14.pyiso8859_14.pyciso8859_14.pyoiso8859_15.pyiso8859_15.pyciso8859_15.pyoiso8859_16.pyiso8859_16.pyciso8859_16.pyoiso8859_2.pyiso8859_2.pyciso8859_2.pyoiso8859_3.pyiso8859_3.pyciso8859_3.pyoiso8859_4.pyiso8859_4.pyciso8859_4.pyoiso8859_5.pyiso8859_5.pyciso8859_5.pyoiso8859_6.pyiso8859_6.pyciso8859_6.pyoiso8859_7.pyiso8859_7.pyciso8859_7.pyoiso8859_8.pyiso8859_8.pyciso8859_8.pyoiso8859_9.pyiso8859_9.pyciso8859_9.pyojohab.pyjohab.pycjohab.pyokoi8_r.pykoi8_r.pyckoi8_r.pyokoi8_u.pykoi8_u.pyckoi8_u.pyolatin_1.pylatin_1.pyclatin_1.pyomac_arabic.pymac_arabic.pycmac_arabic.pyomac_centeuro.pymac_centeuro.pycmac_centeuro.pyomac_croatian.pymac_croatian.pycmac_croatian.pyomac_cyrillic.pymac_cyrillic.pycmac_cyrillic.pyomac_farsi.pymac_farsi.pycmac_farsi.pyomac_greek.pymac_greek.pycmac_greek.pyomac_iceland.pymac_iceland.pycmac_iceland.pyomac_latin2.pymac_latin2.pycmac_latin2.pyomac_roman.pymac_roman.pycmac_roman.pyomac_romanian.pymac_romanian.pycmac_romanian.pyomac_turkish.pymac_turkish.pycmac_turkish.pyombcs.pymbcs.pycmbcs.pyopalmos.pypalmos.pycpalmos.pyoptcp154.pyptcp154.pycptcp154.pyopunycode.pypunycode.pycpunycode.pyoquopri_codec.pyquopri_codec.pycquopri_codec.pyoraw_unicode_escape.pyraw_unicode_escape.pycraw_unicode_escape.pyorot_13.pyrot_13.pycrot_13.pyoshift_jis.pyshift_jis.pycshift_jis.pyoshift_jis_2004.pyshift_jis_2004.pycshift_jis_2004.pyoshift_jisx0213.pyshift_jisx0213.pycs�x������������������X�
�?
\���������L���
�$����������������
�H
�



















	

 !"#$%&'()*+,-./0123456789:;<=>
??????????????????????????????????????????????????????


@@@@
@@
@@@@@

@@@@@

@@

@@@@@@
@@@
@


@
@

AAAAAAABBBBABAAAABBAAABAABBAAAAABAAAAACBABBABABAAAABAAAAAABAADABBCAABAAAdirectoryASCII textPOSIX shell script, ASCII text executableemptyELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=27d6da57a297b6645d5b88b0d767b514d96d878d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4a8c4d5a7f337327658e7d471d06f99a1b100477, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a2434f1c45d056a39dce8a4883e9820b01ed8e09, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6e1379c7ded8330e51389a4aed40271b3ca5c32f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=999adc9a03cafbb36f4afa401c1f014804be265a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=729bc810e505c0ae8a2e7d2dbc3bc1ab3a4a59ae, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ceec1b0cf0eb6eb58545811ef8aba3d9bda4b2e9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=51e74cea33b2c46a48b8601b948d78db95d2031b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7b27fddf8436b5abb46eb17cab565ac9ef7da0c9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f60cedb0875534ff2b9bc6e7d2255ad063a429f6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c6731aad3bfa2012fd27faea43df719789148844, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked,�x�������������(������X�
eb?e37�O��������V2f4f�$/����������������
�V�V�V
�ba1d2ac630e7252c40ba5d35795841aa8dc1b69619950bf2304695df4e6963fbe0c2ee25cd48a75eff03cd0681897a65cad2de78934001dc6b88aeb82f1c3c1cfc13a2b6f9406f1765e0d1a2dfb222b41bbe126b9d567f53639dea3d46d2c2907549ac2e72a705bb325f81e9b8f93f8ee277d18ac2bd0d6849f1facc4de250113f5a546bb0ce7970fc6c6f4f33430704fc1a0bd4547ce1c10d64d25e90fec3cb56b311f7090b47217224f71695705620ecf5754c0603a4da64c35c4deafe9f23d69e998a106da9a0f2868b74e20e12a88bbc6c9a5ab5b68901d2645773f6386196dcdf397380a40d3a06ae468c67cfdd45d504c2c79ee169e971d4a1bd90d947ebb3bbbf881578c2bbb6eccac9391a77cee63ecc9c957b423c7b9c91d813bb273a68921283ea6f0cedcb4cccbcd0556c63988f780bb631b567ed2663383608bfa772f75d2d9385f4ff2f899482b791d39f5af21a12087c9ab66332a3b9e5881261fe1d050d7a90a6301cf756bbc1cdf15c4ae98cd7b9516b51be058655679b7a7170b54b2a92e85356386e425e8828df21836b98872604e5ed70d1dfc2bc531cdec7965e2033935b0004f1695e0850aa090e737ac491254e16807f4d8c9cf8f78433feb043f5e6c2c74a6824b5960d47795394ed1779a6a0be9469aae8741af92c4932f9743617223505e9bf47153013edf21e3125891151f8758ce3b6e1b930e270d311a68ee7f298d7dbea32f221607e947ec35035801251958fbd87f5ba671cee1ba13fbebbe38b76cb58bacd150b4b9cd604378fb7eb6ba549e3b82095c6eca684a7b33a3fc126911d585b908f9d2988c803c94d7b39e63d09f28c3ef89d6a65325b090ceb413716a087cb058cb08bf8cb55a3748040db6cd156b19bcd3a81d4df7f377f5beff52b1100225a595304d09d05fe00d28ca1c8ad6b8d5bd754e20ff4bd07b2d437ee4871d3bca7bebb0c3eb691c9cf37a08379be7719a3d236891c60868b3d94f6ee34c8a837c80057ec3f7720a95fde9e1b35feaba94ef05c07ca1e0c99cb2037f7c29e8f9cdb9ec4916fd436116582bfd378bd77782d4f8ae6bac36cd1bd101b55d6b9e7d2718f48e524a80787ff5a5c33036def361c2677f4bbb31847ff076dff2cf246277f1c3e427784112db404aec0c079510f35164d2008d61f21e7668441221c196856036117c7ec2a24a56dd48ebcd301822c8d584f9b585c47476b32b64a831867ce6b909f721138f147d620fe0294acdab9f86eb38e12144882a5e89816e5f5ec1b518694e34cf59ea81a89cc12c7b2006c3bceb2f2f1bb60060faec056d5b50058422c76c18bfaafc5ad7fd0c78d6266d9b018c96c0aeec0d446875698b5ebb719a5f717742355f02f3cab455bee065c996300f866632d8ebc537ddf2a2eeb30a349fcc7557230b24e5e079b053cf9b94208a99ad25f0cdc625054952e618da3f8a41f5e0ddf5239651d9627ebeddb191d3129c4e408c0ef4064bc33cd83a3ac4bf7450ec6077c220a264c65a87706e8f409a9739ffbb628d862fbdebbb4963170f4b78bfd4f3a47412e95b24477a28233c8c2e5ec74bb99961a93e55ba5ce10f5941a927bd75414d72e72739393ec248c16799003d939324cf51f3e20eef29fc410363746233f921ec3ba9e3557adfdce004bf18b678f1eca382f8f55b9df9ee61e5dd6fe910f92517ca2bf1f63fb4d9ded5c7cb67a84959b07c1f4bc0fa4eb98169318514135892c19aced155a4d457a68c9d11203506660600759d05b27ce478772878276e4d594ef2f5dd585565e873ed7ea2d264e186ab6c90bda7528a9de05180efd8a21ca8f01510df3e530f02b116249bec75dc611e8d2b279f997f33411f10180f2fde905e67dad2af4358bc8aaef647ee14f4a3541eb475165706b4a8d0ddea058e15544490a388fe436a18f623aeb68b0011a524039ef4f0ce09df27de80bc960905160ccc9fada5a329f8a529a19edde9ab1f44fd2fb0b66709405dc06c246ddfd8a473584d126062cedcde65af15d7b7479ba8f4cc555b3bf765c3fcada27708878ebe4ccf9df6902856f4049ce837b4746e518583449029e8e0dab53b58f405ffdc82f9609fc215ebbd0c2ef6dfc1ed66cdef66aa89a3236b89f472e7f0c471cd8535758da74e19bb974e069a1dc8df0dcd59b06aa271fd4483b4b2877bb5b86e43d565fd7cc5b7f3d52842233b5f478b4c922ba5faef55635d14458633d08e584323ce824dde1d4fca8228394270b3b2cf71ab029466f8353a0345f8129ad4e56c59c9387345369f2a63e7de00f47c6661998dd8899aa84ecb37fce1d47b66ee44a76cb0250030cb2973f685b04a0f8b2cf6d5f7d179f9393c9440beff3e6e670c1abe5f098bbf6996babbb2a3d61d74aedfab1d6574863ecab9090ec7336face0b2f61e81d12a6a2f4eebe7d2fc2cbc075e87e416c4f4c458d4e31ba22499caf66da627fdefbdfc0771510b571497324611749303b3d4ad16de8a0b3a7bc6a773954db3dbfa2b7db884d870fa7363df2a8f5291eb9c17d318837da2be5fa22cd8ed6716a21f4cd5699af6910d466bc9a7d37e3bfe15ec2639a3b884f418f5a404d4eb93dfd90de85a8998a710ef1578851fe00a92451c777d02fc87a307e4873b95dd8583e8a638a7af88108ac9311f79edd4072a477cff84acaf7a05841935c00da726f433994607ac79136720ad7dbeeb1048d50d5d02b8531b781fa448b408ed523490ab996fd4f6f131e1809ea56a4e7703a8d9de7f6fab084d96e21cd67be97be75af4776410d500bb5429691f71a2357cffae95b4608be0877�x��������������������X�
es�?bz#2�������� *�ist �$w����������������
���
�n@redhat.com> 1.11.3-7Nalin Dahyabhai <nalin@redhat.com> 1.11.3-6Nalin Dahyabhai <nalin@redhat.com> 1.11.3-5Nalin Dahyabhai <nalin@redhat.com> 1.11.3-4Nalin Dahyabhai <nalin@redhat.com> 1.11.3-3Nalin Dahyabhai <nalin@redhat.com> 1.11.3-2Nalin Dahyabhai <nalin@redhat.com> 1.11.3-1Nalin Dahyabhai <nalin@redhat.com> 1.11.2-10Nalin Dahyabhai <nalin@redhat.com> 1.11.2-9Nalin Dahyabhai <nalin@redhat.com> 1.11.2-8Nalin Dahyabhai <nalin@redhat.com> 1.11.2-7Nalin Dahyabhai <nalin@redhat.com> 1.11.2-6Nalin Dahyabhai <nalin@redhat.com> 1.11.2-5Nathaniel McCallum <npmccallum@redhat.com> 1.11.2-4Nalin Dahyabhai <nalin@redhat.com> 1.11.2-3Nalin Dahyabhai <nalin@redhat.com> 1.11.2-2Nalin Dahyabhai <nalin@redhat.com> 1.11.2-1Nalin Dahyabhai <nalin@redhat.com> 1.11.1-9Nathaniel McCallum <npmccallum@redhat.com> - 1.11.1-8Nalin Dahyabhai <nalin@redhat.com> 1.11.1-7Nalin Dahyabhai <nalin@redhat.com> 1.11.1-6Nalin Dahyabhai <nalin@redhat.com> 1.11.1-5Nalin Dahyabhai <nalin@redhat.com>Nathaniel McCallum <npmccallum@redhat.com> 1.11.1-4Nalin Dahyabhai <nalin@redhat.com> 1.11.1-3Nalin Dahyabhai <nalin@redhat.com> 1.11.1-2Nalin Dahyabhai <nalin@redhat.com> 1.11.1-1Nalin Dahyabhai <nalin@redhat.com> 1.11-2Nalin Dahyabhai <nalin@redhat.com> 1.11-1Nalin Dahyabhai <nalin@redhat.com> 1.11-0.beta2.0Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.11-0.beta1.0Nalin Dahyabhai <nalin@redhat.com> 1.11-0.alpha1.1Nalin Dahyabhai <nalin@redhat.com> 1.11-0.alpha1.0Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.10.3-7Nalin Dahyabhai <nalin@redhat.com> 1.10.3-6Nalin Dahyabhai <nalin@redhat.com> 1.10.3-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.10.3-4Nalin Dahyabhai <nalin@redhat.com> 1.10.3-3Nalin Dahyabhai <nalin@redhat.com> 1.10.3-2Nalin Dahyabhai <nalin@redhat.com> 1.10.3-1Nalin Dahyabhai <nalin@redhat.com> 1.10.2-7Nalin Dahyabhai <nalin@redhat.com> 1.10.2-6Nalin Dahyabhai <nalin@redhat.com> 1.10.2-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.10.2-4Nalin Dahyabhai <nalin@redhat.com> 1.10.2-3Nalin Dahyabhai <nalin@redhat.com> 1.10.2-2Nalin Dahyabhai <nalin@redhat.com> 1.10.2-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.10.1-3Nalin Dahyabhai <nalin@redhat.com> 1.10.1-2Nalin Dahyabhai <nalin@redhat.com> 1.10.1-1Nalin Dahyabhai <nalin@redhat.com> 1.10-5Nathaniel McCallum <nathaniel@natemccallum.com> - 1.10-4Nathaniel McCallum <nathaniel@natemccallum.com> - 1.10-3Nalin Dahyabhai <nalin@redhat.com> 1.10-2Nalin Dahyabhai <nalin@redhat.com> 1.10-1Nathaniel McCallum <nathaniel@natemccallum.com> - 1.10-0.beta1.2Nalin Dahyabhai <nalin@redhat.com> 1.10-0.beta1.1Peter Robinson <pbrobinson@gmail.com>Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha2.2Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha2.1Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha1.3Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha1.2Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha1.1Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha1.0Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.9.1-19Nalin Dahyabhai <nalin@redhat.com> 1.9.1-18Nalin Dahyabhai <nalin@redhat.com> 1.9.1-17Nalin Dahyabhai <nalin@redhat.com> 1.9.1-16Tom Callaway <spot@fedoraproject.org> 1.9.1-15Tom Callaway <spot@fedoraproject.org> 1.9.1-14Tom Callaway <spot@fedoraproject.org> 1.9.1-13Nalin Dahyabhai <nalin@redhat.com> 1.9.1-12Nalin Dahyabhai <nalin@redhat.com> 1.9.1-11Nalin Dahyabhai <nalin@redhat.com> 1.9.1-10Nalin Dahyabhai <nalin@redhat.com> 1.9.1-9Nalin Dahyabhai <nalin@redhat.com> 1.9.1-8Nalin Dahyabhai <nalin@redhat.com> 1.9.1-7Nalin Dahyabhai <nalin@redhat.com> 1.9.1-6Nalin Dahyabhai <nalin@redhat.com> 1.9.1-5Nalin Dahyabhai <nalin@redhat.com> 1.9.1-4Nalin Dahyabhai <nalin@redhat.com> 1.9.1-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9.1-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9.1-1Nalin Dahyabhai�x�������������������X�
 s�?d li���������������} lib�$����������������
}}
}
�tp://www.php.net/releases/7_3_1.php- update to 7.3.1RC1
- oci8 version is now 2.2.0- update to 7.3.0 GA
- update FPM configuration from upstream- update to 7.3.0RC6- update to 7.3.0RC5- test build for https://github.com/php/php-src/pull/3652- update to 7.3.0RC4- update to 7.3.0RC3- update to 7.3.0RC2
- use oracle client library version 18.3- update to 7.3.0RC1
- with oniguruma 6.9.0- add upstream patch for openssl failing test- add upstream patch for F29- update to 7.3.0beta3- update to 7.3.0beta2
- bump API numbers- update to 7.3.0alpha4- update to 7.3.0alpha3- update to 7.3.0alpha2 new sources- update to 7.3.0alpha2
- bump php(zend-abi) and php(api) to 20180606
- revert 5dd1ef90caec3021e6ce55c8554e695edf641eaf- update to 7.3.0alpha1
- switch from pcre to pcre2- update to 7.2.7RC1- Update to 7.2.6 - http://www.php.net/releases/7_2_6.php- rebuild against EL 7.5- update to 7.2.6RC1- Update to 7.2.5 - http://www.php.net/releases/7_2_5.php- update to 7.2.5RC1- add upstream patch for oniguruma 6.8.1, FTBFS #1562583- Update to 7.2.4 - http://www.php.net/releases/7_2_4.php
- FPM: update default pool configuration for process.dumpable- add file trigger to restart the php-fpm service
  when new pool or new extension installed (F27+)- update to 7.2.4RC1- devel: drop dependency on devtoolset- Update to 7.2.3 - http://www.php.net/releases/7_2_3.php
- FPM: revert pid file removal
- improve devel dependencies- rebuild for new tag and drop patch merged upstream
- drop ldconfig scriptlets on F28- update to 7.2.3RC1
- adapt systzdata, fixheader and ldap_r patches
- apply upstream patch for date ext- Update to 7.2.2 - http://www.php.net/releases/7_2_2.php- update to 7.2.2RC1
- define SOURCE_DATE_EPOCH for reproducible build- Update to 7.2.1 - http://www.php.net/releases/7_2_1.php- add upstream patch for https://bugs.php.net/75579- update to 7.2.1RC1- update to 7.2.0 GA- update to 7.2.0RC6- update to 7.2.0RC5- enable argon2 password hash- update to 7.2.0RC4
- oci8 version is now 2.1.8- dont obsolete php72-php-pecl-libsodium- update to 7.2.0RC3- RC3 test build
- F27: php now requires php-fpm and start it with httpd / nginx- update builder from RHEL 7.3 to RHEL 7.4- update to 7.2.0RC2- add patch for EL-6, fix undefined symbol: sqlite3_errstr- update to 7.2.0RC1- test build from git snapshot
- refresh configuration files, sync with upstream, drop .so suffix- test build from git snapshot- test build from git snapshot
- adapt tzdata patch for timelib 2017.05beta7
- disable httpd MPM check- update to 7.2.0beta3- add patch for EL-6, fix undefined symbol: sqlite3_errstr
- revert use of sqlite3_close_v2 on EL-6- update to 7.2.0beta2
- oci8 version is now 2.1.7- update to 7.2.0beta1
- oci8 version is now 2.1.6
- bump apiver and zendver to 20170718- test build
- add sodium extension in new sub-package- update to 7.2.0alpha3- update to 7.2.0alpha2
- oci8 version is now 2.1.5
- use oracle instant client version 12.2- update to 7.2.0alpha1- new snapshot
- use system oniguruma (F26)- new snapshot- test build for release process test, 7.2.0alpha0
- dba: add --with-lmdb build option- new snapshot- new snapshot, May the 4th be with you
- enable PHP execution of .phar files, see #1117140- refresh- update to 7.2.0-dev
- drop mcrypt subpackage (removed upstream)- Update to 7.1.4 - http://www.php.net/releases/7_1_4.php- Update to 7.1.4RC1- Update to 7.1.3 - http://www.php.net/releases/7_1_3.php- fix interbase build on F26- Update to 7.1.3RC1- Update to 7.1.2 - http://www.php.net/releases/7_1_2.php- Update to 7.1.2RC1 (new sources)- Update to 7.1.2RC1- EL-7: add patch for https://bugs.php.net/73956
- switch back to gcc 6.2- EL-7: rebuild using gcc 4.8 instead of 6.2
  because of https://bugzilla.redhat.com/1414348- Update to 7.1.1 - http://www.php.net/releases/7_1_1.php- Update to 7.1.1RC1- test optimized build using GCC 6.2- Update to 7.1.0 - http://www.php.net/releases/7_1_0.php
- use bundled pcre library 8.38 on EL-7
- disable pcre.jit everywhere as it �x��������������������X�
2-�?Dan ���������h���.com�$����������������

� BuildID[sha1]=f6a646a2103761ca4726f6ab0e23cfcf7372703e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=bfe9034b70741d6c6eafc38ca798cb392367857f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b0ef1f8fc3857f8ffe1df47070f3f01c587e526e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d94b1764d85ea18ef1c97700814b7a7b810cbd37, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a5e335152f00f336daad9adda54c0e4e8daf7426, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8d55e60ae0bc835accef70fb84f9acc4b7cf65ad, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d7423cede4f14bf0d8c8c52fdda48316c2d19723, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=de34294eacbc2ee0ae1da3239171b7da8298f105, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=64240caacd66358d1122fa881c04254f9521059e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b469119d6db3f9b8f1e0a12ff2eb3f078fa5da54, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4638a7c0d6132c34426b12a3eb3bb59d5af5f000, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d798eaf18467e0627784388acf34026b5f599c54, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2c4877121d00b5ecf93a819b7249e83176274664, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f2be56e1651c4b09f33fecf164e8ea4679072c69, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=395ca0134ba24898c719a92f0f8f47da29c1f677, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=df95079a081e0b48b0af52fed301367aab04b2ab, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=82a9ef3a3af0fbeb2f826b109b5f0c373d02a7dc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=96e7ac2fdb97e55cdc860a1110489177ff6eae60, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4c075f080cbcee43fc5e0bb848e0c51f344bc039, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=42b8bd2d5ce805edd626c1a4405911779f73d9c5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=15b26530f872a33938727e3d27f2238561af1113, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9f5645b35f2a06ba7fa8b384b60b3e9a674b9fd8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=cc23dc220012d4fe14128668b3f886bc4236af9c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2138d4317b5ab6a8f30e95a9954bab7d9bc68511, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=33eb3c333a4eabdd569fe895c3dc782625642919, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1c10d667a3f387759fa07db17162448778483fe7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=cae2c02fe2c85a37a55786a75f39af617e333e19, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7a707583c2538956491f9bc50c8140523453a7d3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=aae9bea0d2d4773cf7682c9e61ce23099f4642d7, str�x��������������������X�
itv? sha�������������ONvers�$_����������������
ONPNNN
�o looks to see if the string begins with a
   slash for a fully qualified path, if not it looks to see if its a 
   pseudo path such as 'pipe[12345]' or 'socket[12345]' and if so strips out
   the instance information inside the brackets and returns just the type of 
   the pseudo path. This is done because we do not want path information
   in the signature to be unique for each instance of the denial.

- modify the TimeStamp class to hide it's internal datetime member,
   remove the cmp() method, the internal __cmp__ will be automatically invoked.

- require selinux policy version in spec file to allow system dbus use
 
- Resolves bug 256601: audit2allow generates incorrect syntax when comma "," in
   denied list

- update po i18n files

- Add support for pruning database by age and size- fix init script- modify avc_audit.py to use new audit_data.py implementation

- can listen for audit events on either /var/run/audit_events
   in bindary protocol mode or /var/run/audisp_events in
   text protocol mode- remove all copied code from test_setroubleshootd, now we import
   from setroubleshoot
 
- export ClientConnectionHandler from rpc.py as a base class.
   Derive SetroubleshootdClientConnectionHandler and
   AuditClientConnectionHandler from ClientConnectionHandler.

- add audisp_listen as test program

- create setroubleshoot sym link in top devel directory pointing
   to src so import setroubleshoot.foo if PYTHONPATH=topdir

- add get_option, convert_cfg_type to config.py.in so that one
   can pass optional dict to override config file settings

- rewrite log_init() so it's easier for other programs to use it,
   fix the import logic concering log & config

- remove log code from test_setroubleshoot, now just does import
   from setroubleshoot.
 
- test_setroubleshootd can now handle audit records in both text
   and binary formats, can be selected by command line arg. It can now
   either output to clients connecting on a socket or to stdout. Can
   now optionally exit after N socket client connections.

- remove non audit record lines from test data

- remove config_init() and log_init() from package __init__.py
   It was the wrong place to call them, now call them when the
   process initializes before the first setroubleshoot imports

- add parse_config_setting() and set_config() to config module
- setroubleshootd now accepts -c --config command line arg
- test_sectroubleshoot: add err defines & program_error exception
   add is_valid() tests to assure we read a valid audit record
   log the unrecognized line if not valid, clean up socket close()

- Relates Bug #247056, update initscript to LSB standards
   Note: LSB initscripts in Fedora is not yet a resolved issue,
   the changes implemented were to add an LSB block and support
   the new LSB try-restart and force-reload commands. However
   the new /lib/lsb/init-functions are NOT currently used as this
   is the unstable part.- add BuildRequires perl-XML-Parser- move all plugins and their translations to independent package
- wrap XML generation inside try/except
- correct how access list is obtained in avc_auparse.py
- add try/except around top level of AnalyzeThread.run so exceptions
   in the thread get reported and the analysis thread does not just die.
- also add try/except around LogfileThread.process_logfile
- add new function assure_file_ownership_permissions()
- server now forces it's database file permissions/ownership to be 0600 root:root
- rpm now forces the server's database file permissions/ownership to be 0600 root:root
- Resolves Bug #251545: Review Request: setroubleshoot-plugins - analysis plugins for setroubleshoot
- clean up some other rpmlint warnings in setroubleshoot.spec
- fix missing install of setroubleshoot icon and sym link to it
- Resolves Bug #251551, setroubleshoot shows up in in wrong desktop menu
   also run desktop-file-install in rpm install
- add /etc/dbus-1/system.d/setroubleshootd.conf dbus configuration file
- Resolves Bug #250979, Bug #250932 Missing dependencies
- Restore plugins/Makefile.a�x�������������p������X�
G_�	?- paP�Ȩ����5 the�$����������������
555
�d
.%V9X�7E	����>����z�$���

��?}n)�4��{��P��6d�L�
��
��
��
�bl
��
v��
U�c�L���0�
���	�){&E
�dk
9h�
i���sQ�9�}��*DE8
z�
�
�[�
`�
�����AX~a
,�m��C
F�
�;)\i�
��=����8�"�2$9�W4���	Q
}
h2�n�y^9����
�,�]!'Dx�=bh9I�
���i�3+�	�4u
��22;t�:
;�P�~
_M�+��
�HT,'�
��G�����l�u�\�z���TD����GQ���`tg�
�a#�W�
y
�*;?Np���D�6b+�B��� !�	�l��j�/M3an+�8E
�
�S�C'6�
�)S#��

�`}�
�,�]!0bx�=^h9I�w	:h,^*�\T
�n

�);�;z�ElC
�!8f�i��k�#T'�(5�3n��0
r�
M$�<�=.S
hcT�\
L)�QM!|:.�F��1��T!>��V{|@oK
�3=q*
� ���-�J=��$BC��
�b�
�)Ex�4_�v�[�
��
�V�0�8�P�2��	XR
��?�;�
�,�]!-\x�=^h9I�w�)(

$
�	M@��?3�"/d�
N�f*�#
!tR
�P�
��
�2Zq�{���	g	

&
�,aŁ���8���� `�e	
;nl
�J�
%
$�>:���sx�M
��=�z�Q�L
D9�E�P��\
���m��UX�V"��8h<+�
C,`�	oI<�p

��}�
�7K
D
')
g(j�Y/�"�+�!��	�TLl���
(��P��h
���#���
�!D���1�
�
�,����u�/e M ��
��J�k�#����?-R�K��6����'������9�HQ�W�h	�j�XH>8�����9�0��o���	�	�
�c��7n#,�OE

�	H�����A�A聠��A聠A�A聠����A聠A聠A�A�A聠��������A聠������A聠A聠��������������������A聠A聠��������A聠A聠����������A聠A聠��������������������������������������������������A�A�A�A聠������������A聠������������A聠��������A�A聠������������������A聠����A聠����������������������A聠����������������������������������A聠����������A聠������A聠��������A聠����A聠��������������������A聠��������������A聠A聠����������������A聠����������A聠������������A聠��A聠��A聠������������������A聠����������������������������������������������������������A聠������������A聠A聠������A聠����������������A聠������A聠����������A聠��������������������������������������������������������A聠��������������A聠����������A聠A聠������������������������������������������������A聠������A聠��������A聠������������������A聠����A聠��������A聠����������A聠��������������A聠��������A聠��������������������A聠������������A聠������A聠��A聠��������������A聠����������A聠����������������������������������A聠A聠�����x�������������������X�
elI?thatȃ������P�����ƞ in
�$V����������������
ƞŞǞ
� which is probably where it belonged in the first place.- "make_win_bin_dist" and its manual are dropped, cmake does it different.- Add mysql_plugin man page.- Set CXX=g++ by default to add a dependency on libgcc/libstdc++.
  Also, remove the use of the -fno-exceptions and -fno-rtti flags.
  TODO: update distro_buildreq/distro_requires- Add the manual page for "mysql_plugin" to the server package.- Null-upmerge the fix of bug#37165: This spec file is not affected.
- Replace "/var/lib/mysql" by the spec file variable "%{mysqldatadir}".- Source plugin library files list from cmake-generated file.- Added the mysql_plugin client - enables or disables plugins.- Fix bug#12561297: Added the MySQL embedded binary- Fix bug#45415: "rpm upgrade recreates test database"
  Let the creation of the "test" database happen only during a new installation,
  not in an RPM upgrade.
  This affects both the "mkdir" and the call of "mysql_install_db".- Fix bug#56581: If an installation deviates from the default file locations
  ("datadir" and "pid-file"), the mechanism to detect a running server (on upgrade)
  should still work, and use these locations.
  The problem was that the fix for bug#27072 did not check for local settings.- Install the new "manifest" files: "INFO_SRC" and "INFO_BIN".- EXCEPTIONS-CLIENT has been deleted, remove it from here too
- Support MYSQL_BUILD_MAKE_JFLAG environment variable for passing
  a '-j' argument to make.- Added test authentication (WL#1054) plugin binaries- Added example external authentication (WL#1054) plugin binaries- With a recent spec file cleanup, names have changed: A "-community" part was dropped.
  Reflect that in the "Obsoletes" specifications.
- Add a "triggerpostun" to handle the uninstall of the "-community" server RPM.
- This fixes bug#55015 "MySQL server is not restarted properly after RPM upgrade".- Change the behaviour on installation and upgrade:
  On installation, do not autostart the server.
  *Iff* the server was stopped before the upgrade is started, this is taken as a
  sign the administrator is handling that manually, and so the new server will
  not be started automatically at the end of the upgrade.
  The start/stop scripts will still be installed, so the server will be started
  on the next machine boot.
  This is the 5.5 version of fixing bug#27072 (RPM autostarting the server).- Implement SELinux checks from distribution-specific spec file.- Large number of changes to build using CMake
- Introduce distribution-specific RPMs
- Drop debuginfo, build all binaries with debug/symbols
- Remove __os_install_post, use native macro
- Remove _unpackaged_files_terminate_build, make it an error to have
  unpackaged files
- Remove cluster RPMs- Add "--with-perfschema" to the configure options.- User "usr/lib*" to allow for both "usr/lib" and "usr/lib64",
  mask "rmdir" return code 1.
- Remove "ha_example.*" files from the list, they aren't built.- Fix a wrong path name in handling the debug plugins.- Take the result of the debug plugin build and put it into the optimized tree,
  so that it becomes part of the final installation;
  include the files in the packlist. Part of the fixes for bug#49022.- Set "Oracle and/or its affiliates" as the vendor and copyright owner,
  accept upgrading from packages showing MySQL or Sun as vendor.- Formatting changes:
  Have a consistent structure of separator lines and of indentation
  (8 leading blanks => tab).
- Introduce the variable "src_dir".
- Give the environment variables "MYSQL_BUILD_CC(CXX)" precedence
  over "CC" ("CXX").
- Drop the old "with_static" argument analysis, this is not supported
  in 5.1 since ages.
- Introduce variables to control the handlers individually, as well
  as other options.
- Use the new "--with-plugin" notation for the table handlers.
- Drop handling "/etc/rc.d/init.d/mysql", the switch to "/etc/init.d/mysql"
  was done back in 2002 already.
- Make "--with-zlib-dir=bundled" the default, add an option to disable it.
- Add missing manual pages to the file list.
- Improve t�x�������������`�����X�
3aF?676f�������� �����Þ53ee�$S����������������
ޞĞ
��@J�:�I-�I�@I�@H��H��@G��@G�@G�s@F8}@F��F
@E�{@E��E�=�E���E�<�En�E\R�EX^@D��Do�Da�DU�@DR�D<�D;�@D.k@D
u�D$@C��@C�t�C�.�C��@C�O@C�f@C�+�C�@C`�@CV5@CV5@CP�@B�@B�`@Bץ@B��B�:�B��@B�h�B�E@BfD@B]	�BQ,@A�@A�b�Aڅ@A�?@A-�A%�A��Ag@A�@�@@��@@qJ@@+j�@�@@�?��?�@?�\@?�s@?��@?O@@?/�@?�>��>���>l~@>H�>5@=2�@<�{�;��@:��@:Q�9�%@7�7�O�7{X@6�F�6@A�5��Evgeniy Patlan <evgeniy.patlan@percona.com>Evgeniy Patlan <evgeniy.patlan@percona.com> Evgeniy Patlan <evgeniy.patlan@percona.com>Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.11-4Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-3Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-2rc2Tomislav Plavcic <tomislav.plavcic@percona.com> - 5.7.10-1rc1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.9-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.8-0.2.rcBalasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.6-0.2.m16Bjorn Munch <bjorn.munch@oracle.com> - 5.7.6-0.1.m16Erlend Dahl <erlend.dahl@oracle.com> - 5.7.5-0.6.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.5.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.4.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.3.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.2.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.5-0.1.m15Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.5.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.4.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.3.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.2.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.4-0.1.m14Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.3-0.3.m13Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.7.3-0.1.m13Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.15-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-2Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.14-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-5Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-4Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-2 Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.13-1Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-9Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-8Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-7Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-6Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-5Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-4Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-3Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-2Balasubramanian Kandasamy <balasubramanian.kandasamy@oracle.com> - 5.6.12-1Joerg Bruehe <joerg.bruehe@oracle.com>Bjorn Munch <bjorn.munch@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Brajmohan Saxena <brajmohan.saxena@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Jonathan Perkin <jonathan.perkin@oracle.com>Joerg Bruehe <joerg.bruehe@oracle.com>Daniel Fischer <daniel.fischer@oracl�x��������������n�����X�
47}?d9d2���������������HN07e2�$X����������������
HNINGN
�pyrpc_interfaces.pyserver.pyserverconnection.pysignature.pyutil.pyuuid.pyxml_serialize.pysetroubleshootd.servicesetroubleshoot.confsedispatchsetroubleshootdorg.fedoraproject.SetroubleshootFixit.serviceorg.fedoraproject.SetroubleshootPrivileged.serviceorg.fedoraproject.Setroubleshootd.servicesetroubleshoot-serverAUTHORSCOPYINGChangeLogDBUS.mdNEWSREADMETODOsetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.mosetroubleshoot.moseapplet.1.gzsealert.8.gzsedispatch.8.gzsetroubleshootd.8.gzorg.fedoraproject.setroubleshootfixit.policysetroubleshootSetroubleshootFixit.pySetroubleshootPrivileged.pysetroubleshootemail_alert_recipientssetroubleshoot_database.xml/etc/audit/plugins.d//etc/dbus-1/system.d//etc//etc/setroubleshoot//run//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/0c//usr/lib/python3.6/site-packages//usr/lib/python3.6/site-packages/setroubleshoot//usr/lib/python3.6/site-packages/setroubleshoot/__pycache__//usr/lib/systemd/system//usr/lib/tmpfiles.d//usr/sbin//usr/share/dbus-1/system-services//usr/share/doc//usr/share/doc/setroubleshoot-server//usr/share/locale/as/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_GB/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/fur/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/kn/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/mai/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nds/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/or/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/si/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@latin/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/te/LC_MESSAGES//usr/share/locale/th/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1//usr/share/man/man8//usr/share/polkit-1/actions//usr/share//usr/share/setroubleshoot//var/lib//var/lib/setroubleshoot/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc�x�������������P^�����X�
96�	?6a08(�������q����+5f4fb�$;����������������
+5*5,5
�dbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlwdbadminlw�x��������������M�����X�
so_? tar���������������n�.ker�$~����������������
n�m�
	cally linked, BuildID[sha1]=5fff439bb26500ada75a863006e4e40cc72396b4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fdcc86d58fb8dbd43bbfb8a65c345beda00f3b9b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=73767c730bb4600ec9c026c31f1b53047f4c83f1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=208419f315b9dab751a41025f8925d33f9c6dbdb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b34db464a5c956503437eea74e6d557ae316bed9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=59290fdb6ec750ecf7c9185fe8f91dda1df2b864, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e89eb2d540b8eb91352a1ca2dd9d798ccf04669b, strippedUTF-8 Unicode textHTML document, ASCII textC source, ASCII textAlgol 68 source, ASCII textcat << EOF
=====================================================================

  WARNING : PHP 7.4 have reached its "End of Life" in
  November 2022. Even, if this package includes some of
  the important security fixes, backported from 8.0, the
  UPGRADE to a maintained version is very strongly RECOMMENDED.

=====================================================================
EOF/bin/shhttps://forum.remirepo.net/utf-88e33a93b9eba88ba460ea778466245f79c90ca459ca13342974d3e203645e133?���P<�Ka�ː�)O��ə�I�3
!k8��#��+���UP�Y_sZexu
	UP�Y_sZ ��L���P
8h��l�Yr��źU*����6`Q�	2�����*|�;��0�(�{����+��%��tU�n�\����v�euƃ�vhDSn�Տޓ���N*
Q�-W��J �5�n��
�l�Զ�){a��Q�]���z_����H��$�Tl�<�'1M�K�2�`
����Z��c��s�c�_�k��n~ G����dfq*w0����x�o�d}魿���
5��oo�5���i.�88�{_��&	�&<�%�i�"�j(e�𵵲~9�kh�.g�2���?Z��.Q�UE�'|�M�$�
� "Q����t.�
)�+�{K���`�kn�p�z�%��W�6�
�	�����D��p%z��q�&jU��?��녪�{�\;�F�Q
���ZnEߩ�O�rZ���=eLx�n��"��"a�M�"A�[
����"���c����9�Z�ۘ*���w�	�pXp$%c+������+�I�ֹm(��b۸@W+p�����2ef02e57d8139b72bff8027a8e63d907374137cdf4790f1745256debf72aa349e8608b93a9e10ec2301db4b79847050edee61365g>l��g1modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: pl1022_ds: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: mpc8610_hpcd: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: imx-sgtl5000: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: imx-es8328: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: imx-audmix: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: fsl_sai: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: fsl-mqs: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: fsl-esai: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: fsl-audmix: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: eureka-tlv320: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: cros_ec_codec: Use modern ASoC DAI format terminology (Jaroslav Kysela) [2003613]
- ASoC: pcm512x: Mend accesses to the I2S_1 and I2S_2 registers (Jaroslav Kysela) [2003613]
- ASoC: codecs: max98390: simplify getting the adapter of a client (Jaroslav Kysela) [2003613]
- ASoC: Intel: boards: Update to modern clocking terminology (Jaroslav Kysela) [2003613]
- ASoC: SOF: Remove struct sof_ops_table and sof_get_ops() macro (Jaroslav Kysela) [2003613]
- ASoC: rt5682s: make rt5682s_aif2_dai_ops and rt5682s_soc_component_dev (Jaroslav Kysela) [2003613]
- ASoC: tegra: Add Tegra210 based Mixer driver (Jaroslav Kysela) [2003613]
- ASoC: tegra: Add Tegra210 based ADX driver (Jaroslav Kysela) [2003613]
- ASoC: tegra: Add Tegra210 based AMX driver (Jaroslav Kysela) [2003613]
- ASoC: tegra: Add Tegra210 based SFC driver (Jaroslav Kysela) [200�x�������������@=�����X�
as�	?buil��
�G����
up t�$����������������

 
w
���������������zni]XLG;6*%���������������{oj^YMH<7+&	�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
|
p
k
_
Z
N
I
=
8
,
'




���������������}ql`[OJ>9-(���������������~rma\PK?:.)�
�
�
�
�
�
�
�
�
�
�
�
�
�
�

s
n
b
]
Q
L
@
;
/
*




�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	t	o	c	^	R	M	A	<	0	+						����������������upd_SNB=1, 
����������������vqe`TOC>2-!����������������wrfaUPD?3."���������������xsgbVQE@4/#

���������������ythcWRFA50$���������������zuidXSGB61%���el�

�
ۋ�pxE
��$��&
���We�
�
ۋZp��
��$�dr
�ۋLp�1
��$ّܒ
�ۋ)p|2

�ۋp��
����V��

�
ۋ�o44
��$ٿ�
�ۋ�ơ
��$٩�.
�ۋ�oP:
�ۋ�o�7
��$�4�

�ۋao0�
��$�$�
����Cd

�
ۋoȋ
��$ً�+
���/CXv

�
ۋ�m�
���
C�W
�
���v��P^
��$�
�
�Z_��B�
�
����z�G^
��$��
�I
��$ٴB\
�
���:j`.
��$١
�
��$ٜB�[
�
����ddl^
��$كB�[
�
����:
�ۋ��~
��$�X
:
��$�kB�\
�
����+�	
�ۋ@`j

��$�*
<D
��$��A�t
�
�m���

�
�m���

�
�m���

�
�m���

�
�m���

�
�m���

�
�|�t_�q

���We�
�
����9<w
�D���

�t�mf��#
�
�q��5�n

��|�EN�
�� ��dV
����o���
�Wl�@�
�
�9�5y
�]��"�L
�	���C�4
�ۋ�o44
�(���
=
�WlZk0'
�
������
�
B��4t
��g1+
0�

����|��
��{²�

���ݺ4�-
��g�*
Х
���п�T�
��o��6t�
�O;�
$h7
�
��EG4�

�K=r`�
�ۍ��^d�
��}��
����:��
�K=�`�5
�Z_��B�
�
ۍ��
��e�H�H
��$��
�I
��|���6
�ړ��@M
�ۍ���
��+��`D
�R6ٝ�
��F�-8�
��+*�}
��i�H�$r
��$��A�(
�
�F$h|�
��++L"
��$ٱA�.
�
�Fܰl
��+�t�C
��$�x.
�xC8���
��S��>��

��$ٝ;4
�
l*��2��
�"^���R
��+`q�.
�� n��
��|���E
��S�YIt�

�l*�Cj�
��+���*
��$�	t&
�m�~#
�_
��S�r�

��+T
�:
��|�w[��
�l*�80H
�����7
��+m
�
�D��04�
��q�Z?


��|��\

|�H`^ 
0�
{D�1lc

z�q��>
�

xD��,
r�$�>��
pm�~����
m�$��2�R
k
D���]
j�q�{3
�!
h���4

eD���@r
b�q��2
��
`�$���#
`0�NU�+
_
�
��0
D�

^����

]ⶆ�s�L
]�|�Ǹ@�
\]���z�M
[	D�]�8�
Z|B��e��

V��1�?

UD��|�
R�q�)=�)

P|^���

MD�����
J����\y
I|^�"�

E_[��h[
CD��\�5
BY�<�n
A�$�4@"
@�1��_ �
>|^�G�A

=��a�T
;D�[I2
:G��	$

5��a�.
3�$�#�Q
3
��I��4
1G�4|

-�$��"xI
+
D�c�\
*�q�_� �

(�}�\ԡ
&G��d=

%�$ٿ -
#
D�q�|
"���ؼ
!Y�&X\"

oң�X��
D�Q�4^
"^��t2
�q�%d�-

K=	Z��
u�9
X�
Y��	p 
D�O)
Ll
�$ٸ
x
�|����

Y�Q��F

ۋ+HP;
D��"
LD
�q�gh�
�|�Mk��

�JP�$�
]����S

��ۆR�
D��
`d

`
�x��������������,�����X�
- �? bro`�p�
�y de�$q����������������
���
� message on KCM get_princ failure- Fix KDC null dereference on large TGS replies- Explicitly use openssl rather than builtin crypto
- Resolves: #1570910- Merge duplicate subsections in profile library- Restrict pre-authentication fallback cases- Be more careful asking for AS key in SPAKE client- Zap data when freeing krb5_spake_factor- Continue after KRB5_CC_END in KCM cache iteration- Fix SPAKE memory leak- Fix gitignore problem with previous patchset- Add SPAKE support
- Improve protections on internal sensitive buffers
- Improve internal hex encoding/decoding- Fix problem with ccache_name logic in previous build- Add pkinit_anchors default value to krb5.conf
- Reindent krb5.conf to not be terrible- Log preauth names in trace output
- Misc bugfixes from upstream- Add PKINIT KDC support for freshness token- Exit with status 0 from kadmind- Fix hex conversion of PKINIT certid strings- Fix capaths "." values on client
- Resolves: 1551099- Fix flaws in LDAP DN checking
- CVE-2018-5729, CVE-2018-5730- Fix a leak in the previous commit
- Restore dist macro that was accidentally removed
- Resolves: #1540939- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- Process included directories in alphabetical order- Fix network service dependencies
- Resolves: #1525230- New upstream release (1.16)
- No changes from beta2- New upstream prerelease (1.16-beta2)- Fix CVE-2017-15088 (Buffer overflow in get_matching_data())- Drop dependency on python2-pyrad (dead upstream, broken with new python)- Actually bump kdbversion like I was supposed to- New upstream prerelease (1.16-beta1)- Add German translation- New upstream release - krb5-1.15.2
- Adjust patches as appropriate- Save other programs from worrying about CVE-2017-11462
- Resolves: #1488873
- Resolves: #1488874- Add hostname-based ccselect module
- Resolves: #1463665- Backport upstream certauth EKU fixes- Backport certauth eku security fix- Backport kdc policy plugin, but this time with dependencies- Backport kdcpolicy interface* Mon Aug 07 2017 Robbie Harwood <rharwood@redhat.com> - 1.15.1-21
- Display an error message if ocsp pkinit is requested- Disable dns_canonicalize_hostname.  This may break some setups.- Re-enable test suite on ppc64le (no other changes)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Fix CVE-2017-11368 (remote triggerable assertion failure)- Explicitly require python2 packages- Add support to query the SSF of a context
- Pick up rename of perl dependency-  Fix leaks in gss_inquire_cred_by_oid()- Fix arch name (ppc64le, not ppc64el)
- Related-to: #1464381- Skip test suite on ppc64el
- Related-to: #1464381- Include more test suite changes from upstream
- Resolves: #1464381- Fix custom build with -DDEBUG- Use standard trigger logic for krb5 snippet- Add kprop service env config file- Update backports of certauth and corresponding test- Include fixes for previous commit
- Resolves: #1433083- Automatically add includedir where not present
- Try removing sleep statement to see if it is still needed
- Resolves: #1433083- Fix use of enterprise principals with forwarding- Backport certauth plugin and related pkinit changes- Remove duplication between subpackages
- Resolves: #1250228- New upstream release - 1.15.1- Patch build by disabling failing test; will fix properly soon- Hammer refresh around transient rawhide issue- Backport fix for GSSAPI fallback realm- Move krb5-kdb-version provides from -libs to -devel- Add free hook to KDB; increments KDB version
- Add KDB version flag- New upstream release- New upstream release- Ensure we can build with the new CFLAGS
- Remove the git versioning in patches- New upstream release
- Update selinux with RHEL hygene
- Resolves: #1314096- rebuild with OpenSSL 1.1.0, added backported upstream patch- Properly close krad sockets
- Resolves: #1380836- Fix backward check in kprop.service- Switch to using autosetup macro.
  - Patches come from git, so it is easiest to j�x�������������0�����X�
ce�?043a�������� 
�He876�$7����������������
�H��H
�






























































	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������










	
























 
!
"
#
$
%
&
'
(
)
*
+
,
-
.
/
0
1
2
3
4
5
6
7
8
9
:
;
<
=
>
?
@
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d
e
f
g
h
i
j
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z
{
|
}
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�afamanparasastbalbebgbnbnbobrbrxbscacscydadedeeleneoeseteufafifrgaglguhehihrhuiaidiloisitjakakkkmknkokwkw@kkcorkw@uccorkwkyltlvmaimkmlmnmrmsmynbndsnenlnnnsoorpaplptptrorusiskslsqsrsr@latinsvtatetgthtrtwukurviwbayozhzhzhzu�������������1.3.1-39.el8_101.3.1-39.el8_101.3.1-39.el8_10






	

 !!"#$%&'()*+,-./011234567889:;<<<<<<<=============>========================================???????@AABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB�x�������������������X�
b?����������������Uu�$E����������������
UuTu
�G&l?!Td
�
�	
�
�	
�	L
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�	
�
�
�,
�2
<l	�
���
0l�
��8N(q
8x0980:60G�H�IXY\4]d^�b^
d�
e�
f�
l�
t�uv0w �x �y ��!
�!
�!
�!P


!d

!h6
#�
#�6

%�

&

�&P

&T&`
g&d
h&h
Clsscsi0.323.el8List SCSI devices (or hosts) and associated informationUses information provided by the sysfs pseudo file system in Linux kernel
2.6 series to list SCSI devices or all SCSI hosts. Includes a "classic"
option to mimic the output of "cat /proc/scsi/scsi" that has been widely
used prior to the lk 2.6 series.

Author:
--------
    Doug Gilbert <dgilbert(at)interlog(dot)com>af�ord1-prod-x86build001.svc.aws.rockylinux.org
�8KojiRockyGPLv2+infrastructure@rockylinux.orgApplications/Systemhttp://sg.danny.cz/scsi/lsscsi.htmllinuxx86_64
W�jFW�j5'���A�A�A큤������������af�af�af�af�af�_��	_��	_��	_��	_��	_��	af�deb77f0295976fca32b4366c871d88a602eb0d15caff4590ab1f6e55bc0a384830bc7771bd6ef9700f2f787a22799e6937920cfd4671b49d83ad782121c2522edcc100d4161cc0b7177545ab6e47216f84857cda3843847c792a25289852dcaa01430da1c9b10ab7609f2cfd666d05faf2440e2250d39633673090cd661467709fd709a5592e11928b40acd106ca918d9b6dd75cbac44acb3829227d09dc14f474b0b79768250a3c212d37cc31dee12204d6370aff2da591ae34604a4bd43cb68ec5c7a848225aefcc1b4fdabc9f940ee6b3fe49d938d5f73adbf67af2f6276ca1b4162004329e8dae5c7227edc94a8fe81568ee74336d833c9a8e68be15f632../../../../usr/bin/lsscsirootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlsscsi-0.32-3.el8.src.rpm������������������������������������������������lsscsilsscsi(x86-64)@@@@@@







@libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3aS@_��@_���[m~@Y�@Yx�@X��@V�=@U�a@T��S�@S���Q��Q��Q�P��Or�@O�N$ @MQ0@K�@K��Jj�I�2�I��@I9@I9@H5`@G�s@E$�E�D�{�C�:@C�!@B��@A%�@�@?���>���>�s�>a�@>L�@>+�>)A�>#��>d@>c@=��Tomas Bzatek <tbzatek@redhat.com> - 0.32-3Tomas Bzatek <tbzatek@redhat.com> - 0.32-2Tomas Bzatek <tbzatek@redhat.com> - 0.32-1Gris Ge <fge@redhat.com> 0.30-1Fedora Release Engineering <releng@fedoraproject.org> - 0.28-6Fedora Release Engineering <releng@fedoraproject.org> - 0.28-5Fedora Release Engineering <releng@fedoraproject.org> - 0.28-4Fedora Release Engineering <releng@fedoraproject.org> - 0.28-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.28-2Dan Horák <dan[at]danny.cz> - 0.28-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.27-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.27-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.27-2Dan Horák <dan[at]danny.cz> - 0.27-1Fedora Release Engineering <rel-eng@lists.fedoraproje�x������������� ������X�
dd?sing��������h���!C7)-�$1����������������
!C"C C
�/php-src/pull/3652- update to 7.3.0RC4- update to 7.3.0RC3- update to 7.3.0RC2
- use oracle client library version 18.3- update to 7.3.0RC1
- with oniguruma 6.9.0- add upstream patch for openssl failing test- add upstream patch for F29- update to 7.3.0beta3- update to 7.3.0beta2
- bump API numbers- update to 7.3.0alpha4- update to 7.3.0alpha3- update to 7.3.0alpha2 new sources- update to 7.3.0alpha2
- bump php(zend-abi) and php(api) to 20180606
- revert 5dd1ef90caec3021e6ce55c8554e695edf641eaf- update to 7.3.0alpha1
- switch from pcre to pcre2- update to 7.2.7RC1- Update to 7.2.6 - http://www.php.net/releases/7_2_6.php- rebuild against EL 7.5- update to 7.2.6RC1- Update to 7.2.5 - http://www.php.net/releases/7_2_5.php- update to 7.2.5RC1- add upstream patch for oniguruma 6.8.1, FTBFS #1562583- Update to 7.2.4 - http://www.php.net/releases/7_2_4.php
- FPM: update default pool configuration for process.dumpable- add file trigger to restart the php-fpm service
  when new pool or new extension installed (F27+)- update to 7.2.4RC1- devel: drop dependency on devtoolset- Update to 7.2.3 - http://www.php.net/releases/7_2_3.php
- FPM: revert pid file removal
- improve devel dependencies- rebuild for new tag and drop patch merged upstream
- drop ldconfig scriptlets on F28- update to 7.2.3RC1
- adapt systzdata, fixheader and ldap_r patches
- apply upstream patch for date ext- Update to 7.2.2 - http://www.php.net/releases/7_2_2.php- update to 7.2.2RC1
- define SOURCE_DATE_EPOCH for reproducible build- Update to 7.2.1 - http://www.php.net/releases/7_2_1.php- add upstream patch for https://bugs.php.net/75579- update to 7.2.1RC1- update to 7.2.0 GA- update to 7.2.0RC6- update to 7.2.0RC5- enable argon2 password hash- update to 7.2.0RC4
- oci8 version is now 2.1.8- dont obsolete php72-php-pecl-libsodium- update to 7.2.0RC3- RC3 test build
- F27: php now requires php-fpm and start it with httpd / nginx- update builder from RHEL 7.3 to RHEL 7.4- update to 7.2.0RC2- add patch for EL-6, fix undefined symbol: sqlite3_errstr- update to 7.2.0RC1- test build from git snapshot
- refresh configuration files, sync with upstream, drop .so suffix- test build from git snapshot- test build from git snapshot
- adapt tzdata patch for timelib 2017.05beta7
- disable httpd MPM check- update to 7.2.0beta3- add patch for EL-6, fix undefined symbol: sqlite3_errstr
- revert use of sqlite3_close_v2 on EL-6- update to 7.2.0beta2
- oci8 version is now 2.1.7- update to 7.2.0beta1
- oci8 version is now 2.1.6
- bump apiver and zendver to 20170718- test build
- add sodium extension in new sub-package- update to 7.2.0alpha3- update to 7.2.0alpha2
- oci8 version is now 2.1.5
- use oracle instant client version 12.2- update to 7.2.0alpha1- new snapshot
- use system oniguruma (F26)- new snapshot- test build for release process test, 7.2.0alpha0
- dba: add --with-lmdb build option- new snapshot- new snapshot, May the 4th be with you
- enable PHP execution of .phar files, see #1117140- refresh- update to 7.2.0-dev
- drop mcrypt subpackage (removed upstream)- Update to 7.1.4 - http://www.php.net/releases/7_1_4.php- Update to 7.1.4RC1- Update to 7.1.3 - http://www.php.net/releases/7_1_3.php- fix interbase build on F26- Update to 7.1.3RC1- Update to 7.1.2 - http://www.php.net/releases/7_1_2.php- Update to 7.1.2RC1 (new sources)- Update to 7.1.2RC1- EL-7: add patch for https://bugs.php.net/73956
- switch back to gcc 6.2- EL-7: rebuild using gcc 4.8 instead of 6.2
  because of https://bugzilla.redhat.com/1414348- Update to 7.1.1 - http://www.php.net/releases/7_1_1.php- Update to 7.1.1RC1- test optimized build using GCC 6.2- Update to 7.1.0 - http://www.php.net/releases/7_1_0.php
- use bundled pcre library 8.38 on EL-7
- disable pcre.jit everywhere as it raise AVC #1398474
- sync provided configuration with upstream production defaults- Update to 7.1.0RC6- Update to 7.1.0RC5- Update to 7.1.0RC4
- update tzdata patch to v14, improve check for valid tz file
- oci8 version is no�x��������������������X�
�?``�������������$J����������������
���
�ted patches to make keytab-based authentication attempts
    work better when the client tells the KDC that it supports a particular
    cipher, but doesn't have a key for it in the keytab
  - drop backported fix for avoiding spurious clock skew when a TGT is
    decrypted long after the KDC sent it to the client which decrypts it
  - move the cross-referenced HTML docs into the -libs package to avoid
    broken internal links
  - drop patches to fixup paths in man pages, shouldn't be needed any more- tag a couple of other patches which we still need to be applied during
  %{?_rawbuild} builds (zmraz)- actually pull up the patch for RT#7063, and not some other ticket (#773496)- add patch based on one from Filip Krska to not call poll() with a negative
  timeout when the caller's intent is for us to just stop calling it (#838548)- on EL6, conflict with libsmbclient before 3.5.10-124, which is when it
  stopped linking with a symbol which we no longer export (#771687)
- pull up patch for RT#7063, in which not noticing a prompt for a long
  time throws the client library's idea of the time difference between it
  and the KDC really far out of whack (#773496)
- add a backport of more patches to set the client's list of supported enctypes
  when using a keytab to be the list of types of keys in the keytab, plus the
  list of other types the client supports but for which it doesn't have keys,
  in that order, so that KDCs have a better chance of being able to issue
  tickets with session keys of types that the client can use (#837855)- cut down the number of times we load SELinux labeling configuration from
  a minimum of two times to actually one (more of #845125)- backport patch to disable replay detection in krb5_verify_init_creds()
  while reading the AP-REQ that's generated in the same function (RT#7229)- undo rename from krb5-pkinit-openssl to krb5-pkinit on EL6
- version the Obsoletes: on the krb5-pkinit-openssl to krb5-pkinit rename
- reintroduce the init scripts for non-systemd releases
- forward-port %{?_rawbuild} annotations from EL6 packaging- update to 1.10.3, rolling in the fixes from MITKRB5-SA-2012-001- selinux: hang on to the list of selinux contexts, freeing and reloading
  it only when the file we read it from is modified, freeing it when the
  shared library is being unloaded (#845125)- go back to not messing with library file paths on Fedora 17: it breaks
  file path dependencies in other packages, and since Fedora 17 is already
  released, breaking that is our fault- add upstream patch to fix freeing an uninitialized pointer and dereferencing
  another uninitialized pointer in the KDC (MITKRB5-SA-2012-001, CVE-2012-1014
  and CVE-2012-1015, #844779 and #844777)
- fix a thinko in whether or not we mess around with devel .so symlinks on
  systems without a separate /usr (sbose)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- backport a fix to allow a PKINIT client to handle SignedData from a KDC
  that's signed with a certificate that isn't in the SignedData, but which
  is available as an anchor or intermediate on the client (RT#7183)- back out this labeling change (dwalsh):
  - when building the new label for a file we're about to create, also mix
    in the current range, in addition to the current user- update to 1.10.2
  - when building the new label for a file we're about to create, also mix
    in the current range, in addition to the current user
  - also package the PDF format admin, user, and install guides
  - drop some PDFs that no longer get built right
- add a backport of Stef's patch to set the client's list of supported
  enctypes to match the types of keys that we have when we are using a
  keytab to try to get initial credentials, so that a KDC won't send us
  an AS reply that we can't encrypt (RT#2131, #748528)
- don't shuffle around any shared libraries on releases with no-separate-/usr,
  since /usr/lib is the same place as /lib
- add explicit buildrequires: on 'hostname', for the tests, on systems where
  it's in its own pack�x�������������������X�
nf�?h ht�/������0�������9r mi�$D����������������
�9�9�9
�ec8ead00f14582cc82d49, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=46bd6823ca771c4e8280193341e1a43cc04a69e0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4042fdf58b284715ba7e7749bb9865b99a2d19ee, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=dcf5a2caeeb90fac772e61ee69fda0f371ac256b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=76e1de4ddd56fe2bec21d088427a09303af4a12d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7ed2b48016a058b19e2195ecf918288d4e38d2c0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=43f96270833ccc458bddc67be295469cf9399a24, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=adc6ed359c6620b24ef90950c839ef33a4949916, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=61c115b13e9a2193bccbe73e2b6a51d436be81e5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=8ba4040b80f2465d32249174c5b2e62381e2cdc4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=65f4e4a3cf6c4f4e8bbab1dc1de5ca1c05b6204a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=99b958bb264d97143a6bd53eb3b923d58dd5b1c9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=23e1a01098b3314c1eaee31b2398499223f156a5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2cb380cd078355426fcead6f991d6059646aed27, strippeddirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a17af47015992e8edf5e4905ff4909b1f27fd9eb, strippedASCII textPNG image data, 16 x 16, 8-bit colormap, non-interlacedXML 1.0 document, ASCII text, with very long linesXML 1.0 document, UTF-8 Unicode textPNG image data, 300 x 110, 8-bit colormap, non-interlacedtroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)
(2<FPZdnx�������

















RRRR	RRR
RR
RRRRR	RRR
RR
RRRR�x��������������������X�
\�?^:
�������N�d�$^����������������
N�O�M�
�ngs.hweakrefobject.hlibpython2.7.sopython-2.7.pcpython.pcpython2.pcSetupSetup.configSetup.localconfig.cconfig.c.ininstall-shlibpython2.7.somakesetuppython.opython2-develREADME.valgrindgdbinitvalgrind-python.supp/usr/bin//usr/include/python2.7//usr/lib64//usr/lib64/pkgconfig//usr/lib64/python2.7/config//usr/share/doc//usr/share/doc/python2-devel/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu
Python script, ASCII text executableC source, ASCII textASCII textpkgconfig filePOSIX shell script, ASCII text executableELF 64-bit LSB relocatable, x86-64, version 1 (SYSV), with debug_info, not strippeddirectoryRuby script, ASCII text
	



RRP
R
PR
PR
RRutf-898abcd76534f439af529e8c5f0f00421e91f949afc9d86e9982785159be82ed6python27:2.7:8100020240523094844:5f0f67de?���R��3
!pQ�p�)�Tξ7��]�mtZ`fO)�
	�]�mtZ`_��;I2�Ϟ�Yf�r(!�\��įa-��Կ�}��Xy�
	[��jJ��cxee�~u=U("Zw�3�}pE�BO�O��ff
-u!|Y����
/	ӯ��n�oR,�7�%"��A�w��?���Vc{?�3a�g�`íq�)����ed��6-5򩢎eB��y`����@�G�ҁ2����#�e�p�'�U�i����p��Ym{Љd-_H�}i�$k쁆rx���v���
�v�s�}����O�[��1����<��6�CNE�lE�Rͣ�<�r̈��t䒤�!�bXd�o�4ӧQ��D�����t�H�}�?D�>J��e}P���yce�"r��U$W�/�yR/앎�:K
��)G��X�֙e4_�ʌ�"|�V���H^����i���D�P�
\Lݬ(�?���իb�h�"�:AuM������iׁ?�ަ�~-�ಖ�F�r�y��ߜȬ>�`�uh-c�F�}:�ϲ�c+ܲ�j���ų|��II����g:\�X2�H:v�%�a_�Z\q��Vp
��3
!pQ�p�)�Tξ7��]�mtZ`fO)�
	�]�mtZ`�c����:g��.jl�(�c��(\�Ͷ$=�'ʴ�;Ga��z��r=�K¢��7�����}�NZ��7ޔlI������p�f�^Yy��7X�
c�5)
�|����p3>�!ftb2�)�T�
�k���n�x�ӝ)&�j�IMۿ��b��6="Ǿ�st�a�UO�9��fF��N���0���>����f_��g#t�L?i��p�Y���B����59z�U��YY��t[�x��Y\���G��IK�a��"���jq���e�Et��m�d+�'�(��џ*�Aʩ/�-��H�*��B/7ٰA;F�8R���ӧ��G
���G�kA_�-�C&t�sY�5Vx�i��EΓ���|�V:��™b2K�(���ÛE;wc�o��{��ܱ�?֞��
��,����Y-����:@(
����*�����0N�-X	nMAE	:��q;���4]�[�q�X��ƈx�������������������X�
?�����������������C
�$
����������������
CCC
�r https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files norepl�x�������������x������X�
`�?fOh�������� ������4fOj�$n����������������
�4�4�4
�7c13a24793131dca7bf628a8a73b3b178288d1cc6e7d33751f80f2ade9b5dbe1b9ae1d0bea80d44adf9c7b4466fa16447e0812765c6b6e004e977058f506c15d16e1a2c6c4499937549245d1a1d5a1c53e288ec55d7c361361d58bcfcd8627ae88fbeeb598731bc2288bfa068c0e6a5cb6ed1c29d774cda2623fbd957462c2394bf0eb90f4e72dc8db159f0589eda9f36b301e4730a558c7e31fbdb9e02b7259c2eadc4c613e608a137cafb6cae352527c4a55a0a940c438e8f455591471640b500f30e14bf584fcb1040478192db0cd6a743cfc670f00578fb2e7aa3fb1c82ea5d2be9480afba6104e8e28bdb7ab60c291a62111e01ce4183ffc9c04029e3b79c2154b774aad69c31b977e08cfbd774985de6c07d43cbd1101448c3bf83322c5d59520f0dd0eb3190ab9951952b24a17ce81025dd9470cf492bd3a2b42658a9d1617288915f76004b9641adedf57e5be19b280c1f679d1f60ba5a83305b43f2ed663d5c3912c060d58a0d27571fce734bc5cabbef6c2e4dca0219613e2e12ca1a935cf0f57b4b0cf0271afa44736853cfed00189427a20c6e20adedf26e6af5cb14c7520a4d71e6663565c72ea86075f3b12785b2c70086d7f04b471055d9133b084798f840f8f5586c8cb2566fc93b188c6bcd50ead04bf9bd6c6f4293337908ca988466c1f5a6785cc36cfa6626b2ed07077dda3a3889248a938141edc64cfbfeb5babe4ab8110424d05df9493fa8678724effed13fa3ea8e517f6ef617fd3913c63051fc6c2fmysqld.servicemysqld@.servicemysql.confmecabetcmecabrcpluginadt_null.soaudit_log.soauth.soauth_pam.soauth_pam_compat.soauth_socket.soauthentication_ldap_sasl_client.soconnection_control.sodata_masking.inidata_masking.sodebugadt_null.soaudit_log.soauth.soauth_pam.soauth_pam_compat.soauth_socket.soauthentication_ldap_sasl_client.soconnection_control.sodata_masking.sodialog.sogroup_replication.soha_example.soinnodb_engine.sokeyring_file.sokeyring_udf.sokeyring_vault.solibfnv1a_udf.solibfnv_udf.solibmemcached.solibmurmur_udf.solibpluginmecab.solocking_service.somypluglib.somysql_no_login.somysqlx.soquery_response_time.sorewrite_example.sorewriter.soscalability_metrics.sosemisync_master.sosemisync_slave.soudf_example.sovalidate_password.soversion_token.sodialog.sogroup_replication.soha_example.soinnodb_engine.sokeyring_file.sokeyring_udf.sokeyring_vault.solibfnv1a_udf.solibfnv_udf.solibmemcached.solibmurmur_udf.solibpluginmecab.solocking_service.somypluglib.somysql_no_login.somysqlx.soquery_response_time.sorewrite_example.sorewriter.soscalability_metrics.sosemisync_master.sosemisync_slave.soudf_example.sovalidate_password.soversion_token.somysqldmysqld-debugPercona-Server-server-57INFO_BININFO_SRCREADMEinnochecksum.1.gzlz4_decompress.1.gzmy_print_defaults.1.gzmyisam_ftdump.1.gzmyisamchk.1.gzmyisamlog.1.gzmyisampack.1.gzmysql.server.1.gzmysql_install_db.1.gzmysql_plugin.1.gzmysql_secure_installation.1.gzmysql_ssl_rsa_setup.1.gzmysql_tzinfo_to_sql.1.gzmysql_upgrade.1.gzmysqld_multi.1.gzmysqld_safe.1.gzmysqldumpslow.1.gzmysqlman.1.gzperror.1.gzreplace.1.gzresolve_stack_dump.1.gzresolveip.1.gzzlib_decompress.1.gzmysqld.8.gzbulgarianerrmsg.syscharsetsIndex.xmlREADMEarmscii8.xmlascii.xmlcp1250.xmlcp1251.xmlcp1256.xmlcp1257.xmlcp850.xmlcp852.xmlcp866.xmldec8.xmlgeostd8.xmlgreek.xmlhebrew.xmlhp8.xmlkeybcs2.xmlkoi8r.xmlkoi8u.xmllatin1.xmllatin2.xmllatin5.xmllatin7.xmlmacce.xmlmacroman.xmlswe7.xmlczecherrmsg.sysdanisherrmsg.sysdictionary.txtdutcherrmsg.sysenglisherrmsg.syserrmsg-utf8.txtestonianerrmsg.sysfill_help_tables.sqlfrencherrmsg.sysgermanerrmsg.sysgreekerrmsg.syshungarianerrmsg.sysinnodb_memcached_config.sqlinstall_rewriter.sqlitalianerrmsg.sysjapaneseerrmsg.syskoreanerrmsg.sysmagicmysql-log-rotatemysql_security_commands.sqlmysql_sys_schema.sqlmysql_system_tables.sqlmysql_system_tables_data.sqlmysql_test_data_timezone.sqlnorwegiannorwegian-nyerrmsg.syserrmsg.syspolisherrmsg.sysportugueseerrmsg.sysromanianerrmsg.sysrussianerrmsg.sysserbianerrmsg.sysslovakerrmsg.sysspanisherrmsg.sysswedisherrmsg.sysukrainianerrmsg.sysuninstall_rewriter.sqlmysqlmysql-filesmysql-keyringmysqld/etc/logrotate.d//etc//etc/percona-server.conf.d//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build�x�������������������X�
  �?  foXz������`�����}_GMT+�$m����������������
}_~_|_
� calling killproc when stopping dhcrelay (#555672)- Added init script to also start dhcpd for IPv6 (#552453)
- Added dhcpd6.conf.sample- Use %global instead of %define.- dhclient logs its pid to make troubleshooting NM managed systems
  with multiple dhclients running easier (#546792)- Honor DEFROUTE=yes|no for all connection types (#530209)- Make dhclient-script add IPv6 address to interface (#531997)- Fix 56dhclient so network comes back after suspend/hibernate (#527641)- Make dhcpd and dhcrelay init scripts LSB compliant (#522134, #522146)- Obsolete the dhcpv6 and dhcpv6-client packages- Update dhclient-script with handlers for DHCPv6 states- Conditionalize restorecon calls in post scriptlets (#519479)- Do not require policycoreutils for post scriptlet (#519479)- BR libcap-ng-devel (#517649)- Drop unnecessary capabilities in dhclient (#517649)- Upgrade to latest ldap-for-dhcp patch which makes sure that only
  dhcpd links with OpenLDAP (#517474)- Update NetworkManager dispatcher script to remove case conversion
  and source /etc/sysconfig/network- Add /usr/lib[64]/pm-utils/sleep.d/56dhclient to handle suspend and
  resume with active dhclient leases (#479639)- Upgrade to dhcp-4.1.0p1, which is the official upstream release to fix
  CVE-2009-0692- Fix for CVE-2009-0692
- Fix for CVE-2009-1892 (#511834)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Include NetworkManager dispatcher script to run dhclient.d scripts (#459276)- Ensure 64-bit platforms parse lease file dates & times correctly (#448615)- Upgrade to ldap-for-dhcp-4.1.0-4- Set permissions on /etc/dhcp to 0750 (#508247)
- Update to new ldap-for-dhcp patch set
- Correct problems when upgrading from a previous release and your
  dhcpd.conf file not being placed in /etc/dhcp (#506600)- Handle cases in add_timeout() where the function is called with a NULL
  value for the 'when' parameter (#506626)
- Fix SELinux denials in dhclient-script when the script makes backup
  configuration files and restores them later (#483747)- Obsolete libdhcp4client <= 12:4.0.0-34.fc10 (#499290)- Restrict interface names given on the dhcpd command line to length
  IFNAMSIZ or shorter (#441524)
- Change to /etc/sysconfig/network-scripts in dhclient-script before
  calling need_config or source_config (#496233)- Make dhclient-script work with pre-configured wireless interfaces (#491157)- Fix setting default route when client IP address changes (#486512, #473658)
- 'reload' and 'try-restart' on dhcpd and dhcrelay init scripts
  will display usage information and return code 3- Correct %post problems in dhclient package (#495361)
- Read hooks scripts from /etc/dhcp (#495361)
- Update to latest ldap-for-dhcp- Obsolete libdhcp and libdhcp-devel (#493547)- Obsolete libdhcp and libdhcp-devel (#493547)- dhclient obsoletes libdhcp4client (#493213)
- dhcp-devel obsolets libdhcp4client-devel (#493213)- Fix problems with dhclient.d script execution (#488864)- Use LDAP configuration patch from upstream tarball- restorecon fixes for /etc/localtime and /etc/resolv.conf (#488470)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Correct subsystem execution in dhclient-script (#486251)- Do not segfault if the ipv6 kernel module is not loaded (#486097)- Enable dhcpv6 support (#480798)
- Fix config file migration in scriptlets (#480543)
- Allow dhclient-script expansion with /etc/dhcp/dhclient.d/*.sh scripts- rebuild with new openssl- Updated LSB init script header to reference /etc/dhcp/dhcpd.conf (#479012)- Correct syntax errors in %post script (#479012)- Make sure all /etc/dhcp config files are marked in the manifest
- Include new config file directies in the dhcp and dhclient packages
- Do not overwrite new config files if they already exist- Upgraded to ISC dhcp-4.1.0
- Had to rename the -T option to -timeout as ISC is now using -T
- Allow package rebuilders to easily enable DHCPv6 support with:
      rpmbuild --with DHCPv6 dhcp.spec
  Note that Fedora is still using the 'dhcpv6' package, bu�x�������������h������X�
 <�?let@���������Y�������H2.RC�$8����������������
�H�H�H
�BBBBBBBBBBBBBBBBBBACCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCDEEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~���������������������������������������������������������������������������������������������������������������������motd.dpam.dconfig-utilfingerprint-authotherpassword-authpostloginsmartcard-authsystem-authsecurityaccess.confchroot.confconsole.appsconsole.handlersconsole.permsconsole.perms.dfaillock.confgroup.conflimits.conflimits.dnamespace.confnamespace.dnamespace.initopasswdpam_env.confpwhistory.confsepermit.conftime.confmotd.d.build-id0149743a3bcbb8f4b4e6e0948edd404781cf589503252dc20769eb089c68ddb19cec83d250342aea15b26530f872a33938727e3d27f2238561af11131c10d667a3f387759fa07db17162448778483fe72138d4317b5ab6a8f30e95a9954bab7d9bc6851127d6da57a297b6645d5b88b0d767b514d96d878d2c4877121d00b5ecf93a819b7249e8317627466433eb3c333a4eabdd569fe895c3dc782625642919395ca0134ba24898c719a92f0f8f47da29c1f67742b8bd2d5ce805edd626c1a4405911779f73d9c54638a7c0d6132c34426b12a3eb3bb59d5af5f0004a8c4d5a7f337327658e7d471d06f99a1b1004774c075f080cbcee43fc5e0bb848e0c51f344bc03951e74cea33b2c46a48b8601b948d78db95d2031b6057846ff0e17a17c5769a6b1788702fd5ea832264240caacd66358d1122fa881c04254f9521059e650cbf1948f69ad9de311f3a501519f343618e0268287b495e1454221a09b65311623d86a2538e0b6b4254c60d9e184e4a9eb5c883c2afb2f9a4686a6108665a2a05ba11151a5b84c564445ec114fa6e1379c7ded8330e51389a4aed40271b3ca5c32f729bc810e505c0ae8a2e7d2dbc3bc1ab3a4a59aee43430d5b2cc789c6d5c6240013aa397b745ec7a707583c2538956491f9bc50c8140523453a7d37b27fddf8436b5abb46eb17cab565ac9ef7da0c982a9ef3a3af0fbeb2f826b109b5f0c373d02a7dc8549324f50db32558c073df60645b7fc1d13fc94889da55849c98b4373f87c792d7341251e4084b48d55e60ae0bc835accef70fb84f9acc4b7cf65ad965a680e42ef712744949697138cd64589322c6ce7ac2fdb97e55cdc860a1110489177ff6eae60999adc9a03cafbb36f4afa401c1f014804be265a9f5645b35f2a06ba7fa8b384b60b3e9a674b9fd8a2434f1c45d056a39dce8a4883e9820b01ed8e09a5e335152f00f336daad9adda54c0e4e8daf7426aae9bea0d2d4773cf7682c9e61ce23099f4642d7b0ef1f8fc3857f8ffe1df47070f3f01c587e526eb14578213a361bbd1cb2da67516c03662198e25bb257f78554c55c4d35e13fe0bebc529275876505b469119d6db3f9b8f1e0a12ff2eb3f078fa5da54bfe9034b70741d6c6eafc38ca798cb392367857fc6731aad3bfa2012fd27faea43df719789148844cae2c02fe2c85a37a55786a75f39af617e333e19cc23dc220012d4fe14128668b3f886bc4236af9ccd4e3cf9d616d4a2a9a12cd155354deafdf37761ceec1b0cf0eb6eb58545811ef8aba3d9bda4b2e9d7423cede4f14bf0d8c8c52fdda48316c2d1972398eaf18467e0627784388acf34026b5f599c54d94b1764d85ea18ef1c97700814b7a7b810cbd37de34294eacbc2ee0ae1da3239171b7da8298f105df95079a081e0b48b0af52fed301367aab04b2abe0c18106b8bfb0db258552a6d8f349996f74d4a0ed52acd9bb3af0b4c42900163fc260edf3935a5bf2be56e1651c4b09f33fecf164e8ea4679072c69f60cedb0875534ff2b9bc6e7d2255ad063a429f6a646a2103761ca4726f6ab0e23cfcf7372703ef85095d298b92fdfcdf17f95f09ebba9e8b8b609fe16f4af0cf41e838cc8a8866b9c2d7d70b9877amotd.dpam.conflibpam.so.0libpam.so.0.84.2libpam_misc.so.0libpam_misc.so.0.82.1libpamc.so.0libpamc.so.0.82.1securitypam_access.sopam_chroot.sopam_console.sopam_cracklib.sopam_debug.sopam_deny.sopam_echo.sopam_env.sopam_exec.sopam_faildelay.sopam_faillock.sopam_filterpam_filter.soupperLOWERpam_ft�x��������������v�����X�
 F�	? bug��������@�����/5d- �$?����������������
/5.505
�nglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglwprovisioninglw�x�������������Xf�����X�
�?�.���h������h�$y����������������
�h�h�h
�xceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnu












	































































python 3.6 byte-compiledPython script, ASCII text executabledirectoryPython script, UTF-8 Unicode text executableemptyPython script, ASCII text executable, with CRLF line terminatorsASCII textASCII text, with CRLF line terminatorsASCII text, with very long lines, with no line terminatorsXML 1.0 document, ASCII textPython script text executable Python script, ASCII text executableUTF-8 Unicode text
	

 !"#$%&'()*+,-./01236789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~������������������������������������������������������������������������������������������������������x��������������U�����X�
ou�	?5 ad��������`e����95for �$)����������������
9585:5
�REQUESTEDWHEELtop_level.txt_cffi_backend.cpython-36m-x86_64-linux-gnu.so_yaml__init__.pycfficffi-1.15.1.dist-infoINSTALLERLICENSEMETADATARECORDWHEELentry_points.txttop_level.txt__init__.py_cffi_errors.h_cffi_include.h_embedding.hapi.pybackend_ctypes.pycffi_opcode.pycommontypes.pycparser.pyerror.pyffiplatform.pylock.pymodel.pyparse_c_type.hpkgconfig.pyrecompiler.pysetuptools_ext.pyvengine_cpy.pyvengine_gen.pyverifier.pycryptographycryptography-40.0.2.dist-infoINSTALLERLICENSELICENSE.APACHELICENSE.BSDLICENSE.PSFMETADATARECORDWHEELtop_level.txt__about__.py__init__.pyexceptions.pyfernet.pyhazmat__init__.py_oid.pybackends__init__.pyopenssl__init__.pyaead.pybackend.pyciphers.pycmac.pydecode_asn1.pydh.pydsa.pyec.pyed25519.pyed448.pyhashes.pyhmac.pypoly1305.pyrsa.pyutils.pyx448.pybindings__init__.py_rust_rust.abi3.so__init__.pyi_openssl.pyiasn1.pyiocsp.pyiopenssl__init__.pyix25519.pyipkcs7.pyix509.pyiopenssl__init__.py_conditional.pybinding.pyprimitives__init__.py_asymmetric.py_cipheralgorithm.py_serialization.pyasymmetric__init__.pydh.pydsa.pyec.pyed25519.pyed448.pypadding.pyrsa.pytypes.pyutils.pyx25519.pyx448.pyciphers__init__.pyaead.pyalgorithms.pybase.pymodes.pycmac.pyconstant_time.pyhashes.pyhmac.pykdf__init__.pyconcatkdf.pyhkdf.pykbkdf.pypbkdf2.pyscrypt.pyx963kdf.pykeywrap.pypadding.pypoly1305.pyserialization__init__.pybase.pypkcs12.pypkcs7.pyssh.pytwofactor__init__.pyhotp.pytotp.pypy.typedutils.pyx509__init__.pybase.pycertificate_transparency.pyextensions.pygeneral_name.pyname.pyocsp.pyoid.pypsycopg2psycopg2-2.9.8.dist-infoINSTALLERLICENSEMETADATARECORDREQUESTEDWHEELtop_level.txt__init__.py_ipaddress.py_json.py_psycopg.cpython-36m-x86_64-linux-gnu.so_range.pyerrorcodes.pyerrors.pyextensions.pyextras.pypool.pysql.pytz.pyyaml__init__.py_yaml.cpython-36m-x86_64-linux-gnu.socomposer.pyconstructor.pycyaml.pydumper.pyemitter.pyerror.pyevents.pyloader.pynodes.pyparser.pyreader.pyrepresenter.pyresolver.pyscanner.pyserializer.pytokens.pypyvenv.cfglwdbadmin-python3README.mdlwdbadminlwdbadminlwdbadmin.log/etc/uwsgi.d//opt/lc/lwdbadmin/bin//opt/lc/lwdbadmin//opt/lc/lwdbadmin/etc//opt/lc/lwdbadmin/etc/bash_completion.d//opt/lc/lwdbadmin/etc/cron.d//opt/lc/lwdbadmin/etc/locaweb//opt/lc/lwdbadmin/etc/locaweb/lwdbadmin//opt/lc/lwdbadmin/etc/profile.d//opt/lc/lwdbadmin/etc/uwsgi.d//opt/lc/lwdbadmin/lib//opt/lc/lwdbadmin/lib/lwdbadmin-1.0.1-py3.6.egg-info//opt/lc/lwdbadmin/lib/lwdbadmin//opt/lc/lwdbadmin/lib/lwdbadmin/__pycache__//opt/lc/lwdbadmin/lib/lwdbadmin/api//opt/lc/lwdbadmin/lib/lwdbadmin/api/__pycache__//opt/lc/lwdbadmin/lib/lwdbadmin/mysql//opt/lc/lwdbadmin/lib/lwdbadmin/mysql/__pycache__//opt/lc/lwdbadmin/lib/lwdbadmin/pgsql//opt/lc/lwdbadmin/lib/lwdbadmin/pgsql/__pycache__//opt/lc/lwdbadmin/virtualenv//opt/lc/lwdbadmin/virtualenv/bin//opt/lc/lwdbadmin/virtualenv/lib//opt/lc/lwdbadmin/virtualenv/lib/python3.6//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/OpenSSL//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/PyMySQL-1.0.2.dist-info//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/_distutils_hack//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip-21.3.1.dist-info//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/cli//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/commands//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/distributions//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/index//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/locations//opt/lc/lwdbadmin/virtualenv/lib/python3.6/site-packages/pip/_internal/metadata//opt/lc/lwdbadmin/v�x�������������HE�����X�
�?P���Pa�����4�$b����������������
�4�4�4
�sr/lib64/mysql/plugin/debug/libfnv1a_udf.so../../../../usr/lib64/mysql/plugin/debug/audit_log.so../../../../usr/bin/lz4_decompress../../../../usr/sbin/mysqld../../../../usr/lib64/mysql/plugin/debug/keyring_file.so../../../../usr/bin/mysql_install_db../../../../usr/lib64/mysql/plugin/debug/auth_pam_compat.so../../../../usr/lib64/mysql/plugin/debug/locking_service.so../../../../usr/lib64/mysql/plugin/libmemcached.so@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootr�x��������������4�����X�
�?hW���x>���*��$:����������������
*�+�)�
�f23bbb636f2ea194271b488dc20957e25fc9387851016a08eaa6e7876f59658b4d97737d40540499d3fb68f45dc1194e86f757fa940120046e19daadc7927a41ac8a6463152dd4ebc92773cf2eeb090e4cc29180f7a93726c5fab7980ab6dfc0c84e545a778a0e941a30e163265c6a99bded89079a1d59004365605a5d626934eb1fdb2db60a4c28f7d9726ac48edd949ab6d99c3816a988f8b29d72e075da4d77c0aa05a11c8cfbeff07105ccb4fd557ac9ef7a0519ea879f2a5e0fe4d6c88e6d92c8e834ea75d574810c89d1a9a63dbc3f98827253e242a2868e234ad0a47dd714883f6c05fb1e411f4f142b3e0d1eb4318bcf8ef4d51e5235bb99af72ee61bf29f86b2687b6c04b7fb65ae110af5829dc61dae7e7a35cf1badc80fac2be830adfac88518ad516aae5ce7f2e5bcf716e8577c2c6669a91bb986ac812669e2f234b56820ad0c4dd407876b4594edb7b48f0a8dcb2efd3b8cd9e9dc65875e3bc2fe15b4a647f493123261767d35c5baf35d5f8c1158954411d156896ca3a3187466132e8a9e32b86fc412d8ec8c26f18431dc1b653a9613f383f985d0cbc27371e05ff460d13bed2fbba1da383d4c19f3f6535c697570947a9b8fabe43434eaab1e376c93559f7baccb57cfa1aa28897a44c0dff23fe55ae3b69bf54ed7bb71fa883ff2caa754f7a05e2918e5795939b28a4160cfa8dae309076c3ff18bb66c875c31af56c70ed21656f0f042a0ed6642e8ba6ae39febd25bc9a595a63c262a0a2e057a6b886429ed86a04ecc16de4e5d2cb6fef713e611f23918936bd1d7a4d5d56e6a14278fea8ae7533e431e11bd310cc063e4e106e0457cef2592ee256c80d7ce8c23f6d0cc49301fa071fe8ef2b67b7a2dad8d1fbe33a5f6389ed9adb81c1a77f9bf14ce17782a3be654111beea04c72bab7c5644e88937423fbb432421b532da7055739f48d290efa923237fe1082706c8d6c8fef4ce4101469c511ab932e475e082f7f7d5c908e557a2395ee1b813bfe6b8f5f9428e686770b858e38e5c6b9e1145d87287ad227d185b9c69e4a02939c39e7b1afb2b5783d0d808f1def2ab23d388c78efb886976aecefe8fc0f94b0fff349faebe97602dacbf1af419077faf569379966f0109dd5cc29e8931f5f9fa39cac9666237a802bdcee3c5c83b861bd85312aeadeee5e1cf91c3f8319d201ae54aeaeace34943ae7509c9a63bfdef0f3f56da8197765f97d01bf3f878f02081d4de04dea0545827064819c86bbc36fb7337fa2b8c1eff7bc53e8b1f73a9346c3c3d8f259cbf92e4c1799702235e82b774c0cef45caeda05fc9dc65bbefca34b8cc417ec1c3411b1804cf97a1340fb8a646008344fad2109f3460ea2b3867651c20353ca8cba16a3662476858d4ff8411a26287da413cb26265fe5c67762fad66407cf97ee4e76cf74a3c53378df08843a10e8c6a35f280d4623e3b596d46dae2faf0841cec38a247e850406a42d7d3b8af5567a9dd4e87ffb298deaf2215ba27766873bafdb49d587c9ed73d96982dd4f64e17f6da42f807df84725922a17ff91b4241973558c69676187b8533765bb15e4b64f3c845b606ab4b9bf5997e13f4f62ecf4f384b8ff64b09b09ebdfc08e5a794d874b065f8a04970c6db04637fbd495577e882968cc30c77fb5acefcb54ab839123c70b1a3ac8a5130f0e1a3709683c6c57c180d29341828e4de649267698ea9dd1f6b4a99d63848aaa96cd22b10f0242dfb180b02ff394797afcf3bfc9c75e3aca1242370603a997f9258601a21dca4f735f89fd6d0145abd065e426242e4c09be9d811c95a980dbc2c33b7cffafbcacbd86851c839d9d8335e4ac595ffdb9c247893db00699b221483d2c9413e746e3426f235c00ed87238a74d5b31d4c7c660888e9a2c0cbff1265ec2602afc89ab72914eb078cb4ad36593a6900837ad0f66d91360e2e49bbacc083a8a5a637be3165eb411e8b4b41bdb3d1bae73be97e57f5a1ccdccd782eb73265b200dce8316912e9738dd4d32174815dd556c73f04c6ccea1e1636dce29c550e6be9693d8672b9714c6b9b69706f5e1d381af467106b9fb85f7359e956e2d00f9ca6a3dc7bcbc3018fe730d23c33cddc6d3e3fee5df26044ec283d34ab5f0813fee4f2bf666fa8fb1e66384e2a10746f3483749cae8efac62770e8a541bd042dd51d2fd089620be823b858bdd7aa6df9c36ee9c640fefd901f3164358a67b8e766bee35c16b66fbc5d4b5e3fbde0f0c69bce80e7a4b8cd4156f46d97ed0153d24046df2e617c8191e17133d98e7a2ab3ffd330b4debb0bfc10fea21e4b2b5a5b09de2e924293be5ff088177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643ad5eea51431e428fa2d01e0ba6c56535dfe95becd469462f4b3ef43ee0b2b73fdd3f7744d3e6efdeb8c58d3d894b7cb1f8ba7c785d72880cbd4ed0c026b5c29f53e70faa0ad5266ec30b8639707e7b61c2156ecb32c89253265f70853e276590ca6a4122569217197d1c4414d5c2ae5fbf0086c63b02d48ae9db48f28cfbc26d70d6312173321a5a9d3886416bbe7b09786a621b8130696d5c04ef6b8a5969dee27edae75df5f243f8f307c4af83e216b041dbe99555f8d51ada4954b6e8ce778196e719d86e1923c60f341b0416c0268297a67236aa0d9489150131ba5d6cb55cc696c24c0c459e6dd2d7a019ca410455f3c274391ff528d47e064eddc152f3f1771baa6ac5c33d1dab08444eea795f651862fd1a3c8b146475c28cebc5b99794a94fb1978833b71b6d63fdac058bb0c6dc65798bc2fca79f�x�������������8$�����X�
le�?ch i@/������h/�����_- Re�$����������������
�_�_�_
�David Cantrell <dcantrell@redhat.com> - 12:4.0.0-14David Cantrell <dcantrell@redhat.com> - 12:4.0.0-13David Cantrell <dcantrell@redhat.com> - 12:4.0.0-12David Cantrell <dcantrell@redhat.com> - 12:4.0.0-11David Cantrell <dcantrell@redhat.com> - 12:4.0.0-10David Cantrell <dcantrell@redhat.com> - 12:4.0.0-9David Cantrell <dcantrell@redhat.com> - 12:4.0.0-8David Cantrell <dcantrell@redhat.com> - 12:4.0.0-7David Cantrell <dcantrell@redhat.com> - 12:4.0.0-6David Cantrell <dcantrell@redhat.com> - 12:4.0.0-5David Cantrell <dcantrell@redhat.com> - 12:4.0.0-4David Cantrell <dcantrell@redhat.com> - 12:4.0.0-3David Cantrell <dcantrell@redhat.com> - 12:4.0.0-2David Cantrell <dcantrell@redhat.com> - 12:4.0.0-1David Cantrell <dcantrell@redhat.com> - 12:3.1.0-12David Cantrell <dcantrell@redhat.com> - 12:3.1.0-11David Cantrell <dcantrell@redhat.com> - 12:3.1.0-10David Cantrell <dcantrell@redhat.com> - 12:3.1.0-9David Cantrell <dcantrell@redhat.com> - 12:3.1.0-8David Cantrell <dcantrell@redhat.com> - 12:3.1.0-7David Cantrell <dcantrell@redhat.com> - 12:3.1.0-6David Cantrell <dcantrell@redhat.com> - 12:3.1.0-5David Cantrell <dcantrell@redhat.com> - 12:3.1.0-4David Cantrell <dcantrell@redhat.com> - 12:3.1.0-3David Cantrell <dcantrell@redhat.com> - 12:3.1.0-2David Cantrell <dcantrell@redhat.com> - 12:3.1.0-1David Cantrell <dcantrell@redhat.com> - 12:3.0.6-8David Cantrell <dcantrell@redhat.com> - 12:3.0.6-7David Cantrell <dcantrell@redhat.com> - 12:3.0.6-6David Cantrell <dcantrell@redhat.com> - 12:3.0.6-5David Cantrell <dcantrell@redhat.com> - 12:3.0.6-4David Cantrell <dcantrell@redhat.com> - 12:3.0.6-3Florian La Roche <laroche@redhat.com> - 12:3.0.6-2David Cantrell <dcantrell@redhat.com> - 12:3.0.6-1David Cantrell <dcantrell@redhat.com> - 12:3.0.5-37David Cantrell <dcantrell@redhat.com> - 12:3.0.5-36David Cantrell <dcantrell@redhat.com> - 12:3.0.5-35David Cantrell <dcantrell@redhat.com> - 12:3.0.5-34David Cantrell <dcantrell@redhat.com> - 12:3.0.5-33David Cantrell <dcantrell@redhat.com> - 12:3.0.5-32David Cantrell <dcantrell@redhat.com> - 12:3.0.5-31David Cantrell <dcantrell@redhat.com> - 12:3.0.5-30David Cantrell <dcantrell@redhat.com> - 12:3.0.5-29David Cantrell <dcantrell@redhat.com> - 12:3.0.5-28David Cantrell <dcantrell@redhat.com> - 12:3.0.5-27David Cantrell <dcantrell@redhat.com> - 12:3.0.5-26David Cantrell <dcantrell@redhat.com> - 12:3.0.5-25David Cantrell <dcantrell@redhat.com> - 12:3.0.5-24David Cantrell <dcantrell@redhat.com> - 12:3.0.5-23David Cantrell <dcantrell@redhat.com> - 12:3.0.5-22David Cantrell <dcantrell@redhat.com> - 12:3.0.5-21David Cantrell <dcantrell@redhat.com> - 12:3.0.5-20David Cantrell <dcantrell@redhat.com> - 12:3.0.5-19David Cantrell <dcantrell@redhat.com> - 12:3.0.5-18David Cantrell <dcantrell@redhat.com> - 12:3.0.5-17David Cantrell <dcantrell@redhat.com> - 12:3.0.5-16David Woodhouse <dwmw2@redhat.com> - 12:3.0.5-15David Cantrell <dcantrell@redhat.com> - 12:3.0.5-14David Cantrell <dcantrell@redhat.com> - 12:3.0.5-13David Cantrell <dcantrell@redhat.com> - 12:3.0.5-12David Cantrell <dcantrell@redhat.com> - 12:3.0.5-11David Cantrell <dcantrell@redhat.com> - 12:3.0.5-10David Cantrell <dcantrell@redhat.com> - 12:3.0.5-9David Cantrell <dcantrell@redhat.com> - 12:3.0.5-8Peter Jones <pjones@redhat.com> - 12:3.0.5-7David Cantrell <dcantrell@redhat.com> - 12:3.0.5-6David Cantrell <dcantrell@redhat.com> - 12:3.0.5-5David Cantrell <dcantrell@redhat.com> - 12:3.0.5-4David Cantrell <dcantrell@redhat.com> - 12:3.0.5-3David Cantrell <dcantrell@redhat.com> - 12:3.0.5-2David Cantrell <dcantrell@redhat.com> - 12:3.0.5-1David Cantrell <dcantrell@redhat.com> - 12:3.0.4-24David Cantrell <dcantrell@redhat.com> - 12:3.0.4-23David Cantrell <dcantrell@redhat.com> - 12:3.0.4-22David Cantrell <dcantrell@redhat.com> - 12:3.0.4-21Jesse Keating <jkeating@redhat.com> - 12:3.0.4-20David Cantrell <dcantrell@redhat.com> - 12:3.0.4-19David Cantrell <dcantrell@redhat.com> - 12:3.0.4-18Jesse Keating <jkeating@redhat.com> - 12:3.0.4-17.1Peter J�x�������������������X�
.0J?ta3������`&���<>a2
-�$,����������������
<>�@
���x����}���u��B���EGꎤC�2����S2@�hʺ��=�!F�@��dpz��� �N(�$�Q�{?q�]G��/�Ῥ�zs�̱�1h�J_F�Z��of��qqB��8�5{d�
���̟�����?^��ގ#*���6��7]�C��hxKW����ɔ���}�<~��Ď\��eإC��a�h�Eߺ�EX����(�>V���x=Cj�.-��jE�3
!pQ�p�)�Tξ7��]�mtZ``s��
	�]�mtZ`���G/�I�Pg%�;k�I�sw���
vD5q��/w�^�&��C���IG���n�ҩҎ"�=Q�y
��lu&�E�B�a)�d�C�%�`ea>�|��x<JM��/`iQğG����/���q�K����]3���5\z�"�J��F��h��e,	�"q�s�73������2\O8�gZ$��;���@�j%m/�[��F�7�{ٱN��FP��#װP�*r\�[�N��ӡ����+���	��l�C^;��8,�a��w�FJ+Ze���
J"��gp�'_�
�|�͎������ӵ��ȏ����ƿ`q{�涍Y
>��� ,\�Q7�xR1
�*���cs��D�:�8���Ʊ����c�"T�!Ą#+ZK{�C�B�Ón���Ae��kc��W�fی�PM@���[����I��,�b��V�^�?c�c�F�,A$ƽiuv�}����d��Ĵ��zq|RRs���5.�_�bz�j�6����Q8�-�:N?�T�7797279a4f7d0737502df472933868118586381ef4576d8064d25cb69fd0cfded3ee5a9c7b8dd3305917f37d5e914153b38f7d6ff��$�f��$: bpf_setsockopt: reset sock dst on SO_MARK changes (Jiri Benc) [1687459]
- [net] bpf: correctly set initial window on active Fast Open sender (Jiri Benc) [1687459]
- [net] xsk: simplify AF_XDP socket teardown (Jiri Benc) [1687459]
- [net] bpf: fix doc of bpf_skb_adjust_room() in uapi (Jiri Benc) [1687459]
- [net] bpf: do not blindly change rlimit in reuseport net selftest (Jiri Benc) [1687459]
- [net] xsk: proper AF_XDP socket teardown ordering (Jiri Benc) [1687459]
- [net] bpf: typo fix in Documentation/networking/af_xdp.rst (Jiri Benc) [1687459]
- [net] xdp: split code for map vs non-map redirect (Jiri Benc) [1687459]
- [net] xdp: explicit inline __xdp_map_lookup_elem (Jiri Benc) [1687459]
- [net] xdp: unlikely instrumentation for xdp map redirect (Jiri Benc) [1687459]
- [net] xdp: remove redundant variable 'headroom' (Jiri Benc) [1687459]
- [net] xsk: include XDP meta data in AF_XDP frames (Jiri Benc) [1687459]
- [net] bpf: Enable BPF_PROG_TYPE_SK_REUSEPORT bpf prog in reuseport selection (Jiri Benc) [1687459]
- [net] revert "xdp: add NULL pointer check in __xdp_return()" (Jiri Benc) [1687459]
- [lib] test_rhashtable: Make test_insert_dup() allocate its hash table dynamically (Jiri Benc) [1717066]
- [lib] test_rhashtable: remove semaphore usage (Jiri Benc) [1717066]
- [lib] rhashtable: detect when object movement between tables might have invalidated a lookup (Jiri Benc) [1717066]
- [lib] rhashtable: remove duplicated include from rhashtable.c (Jiri Benc) [1717066]
- [lib] rhashtable: clean up dereference of ->future_tbl (Jiri Benc) [1717066]
- [lib] rhashtable: use cmpxchg() to protect ->future_tbl (Jiri Benc) [1717066]
- [lib] rhashtable: simplify nested_table_alloc() and rht_bucket_nested_insert() (Jiri Benc) [1717066]
- [lib] rhashtable: simplify INIT_RHT_NULLS_HEAD() (Jiri Benc) [1717066]
- [lib] rhashtable: remove nulls_base and related code (Jiri Benc) [1717066]
- [lib] rhashtable: split rhashtable.h (Jiri Benc) [1717066]
- [lib] rhashtable: silence RCU warning in rhashtable_test (Jiri Benc) [1717066]
- [net] devlink: publish params only after driver init is done (Ivan Vecera) [1715929]
- [net] iptunnel: NULL pointer deref for ip_md_tunnel_xmit (Hangbin Liu) [1712792]
- [net] ip_gre: Refactor collect metatdata mode tunnel xmit to ip_md_tunnel_xmit (Hangbin Liu) [1712792]
- [net] ip_tunnel: Fix route fl4 init in ip_md_tunnel_xmit (Hangbin Liu) [1712792]
- [net] ip_tunnel: Add tnl_update_pmtu in ip_md_tunnel_xmit (Hangbin Liu) [1712792]
- [net] ip_tunnel: Add ip tunnel dst_cache in ip_md_tunnel_xmit (Hangbin Liu) [1712792]
- [net] vlan: Mark expected switch fall-through (Hangbin Liu) [1664359]
- [net] vlan: disable SIOCSHWTSTAMP in container (Hangbin Liu) [1664359]
- [netdrv] macvlan: Mark expected switch fall-through (Hangbin Liu) [1664359]
- [netdrv] macvlan: disable SIOCSHWTSTAMP in container (Hangbin Liu) [1664359]
- [netdrv] macvlan: pass get_ts_info and SIOC[SG]HWTSTAMP ioctl to real device (Hangbin Liu) [1664359]
- [net] ethtool: add compat for flash update (Petr Oros) [1708339]
- [net] devlink: add flash update command (Petr Oros) [1708339]
- [net] devlink: Fix list access w�x�������������(�����X�
sc? add��������������'Cerfa�$7����������������
'C(C&C
�mi@remirepo.net> - 7.3.2-3Remi Collet <remi@remirepo.net> - 7.3.2-2Remi Collet <remi@remirepo.net> - 7.3.2-1Remi Collet <remi@remirepo.net> - 7.3.2~RC1-1Remi Collet <remi@remirepo.net> 7.3.1-3Remi Collet <remi@remirepo.net> - 7.3.1-2Remi Collet <remi@remirepo.net> - 7.3.1-1Remi Collet <remi@remirepo.net> - 7.3.1~RC1-1Remi Collet <remi@remirepo.net> - 7.3.0-1Remi Collet <remi@remirepo.net> - 7.3.0~rc6-1Remi Collet <remi@remirepo.net> - 7.3.0~rc5-1Remi Collet <remi@remirepo.net> - 7.3.0~rc4-2Remi Collet <remi@remirepo.net> - 7.3.0~rc4-1Remi Collet <remi@remirepo.net> - 7.3.0~rc3-1Remi Collet <remi@remirepo.net> - 7.3.0~rc2-1Remi Collet <remi@remirepo.net> - 7.3.0~rc1-1Remi Collet <remi@remirepo.net> - 7.3.0~beta3-3Remi Collet <remi@remirepo.net> - 7.3.0~beta3-2Remi Collet <remi@remirepo.net> - 7.3.0~beta3-1Remi Collet <remi@remirepo.net> - 7.3.0~beta2-1Remi Collet <remi@remirepo.net> - 7.3.0~alpha4-1Remi Collet <remi@remirepo.net> - 7.3.0~alpha3-1Remi Collet <remi@remirepo.net> - 7.3.0~alpha2-2Remi Collet <remi@remirepo.net> - 7.3.0~alpha2-1Remi Collet <remi@remirepo.net> - 7.3.0~alpha1-1Remi Collet <remi@remirepo.net> - 7.2.7~RC1-1Remi Collet <remi@remirepo.net> - 7.2.6-1Remi Collet <remi@remirepo.net> - 7.2.6~RC1-2Remi Collet <remi@remirepo.net> - 7.2.6~RC1-1Remi Collet <remi@remirepo.net> - 7.2.5-1Remi Collet <remi@remirepo.net> - 7.2.5~RC1-1Remi Collet <remi@remirepo.net> - 7.2.4-2Remi Collet <remi@remirepo.net> - 7.2.4-1Remi Collet <remi@remirepo.net> - 7.2.4~RC1-2Remi Collet <remi@remirepo.net> - 7.2.4~RC1-1Remi Collet <remi@remirepo.net> - 7.2.3-2Remi Collet <remi@remirepo.net> - 7.2.3-1Remi Collet <remi@remirepo.net> - 7.2.3~RC1-3Remi Collet <remi@remirepo.net> - 7.2.3~RC1-2Remi Collet <remi@remirepo.net> - 7.2.2-1Remi Collet <remi@remirepo.net> - 7.2.2~RC1-1Remi Collet <remi@remirepo.net> - 7.2.1-1Remi Collet <remi@remirepo.net> - 7.2.1~RC1-2Remi Collet <remi@remirepo.net> - 7.2.1~RC1-1Remi Collet <remi@remirepo.net> - 7.2.0-1Remi Collet <remi@remirepo.net> - 7.2.0-0.31.RC6Remi Collet <remi@remirepo.net> - 7.2.0-0.30.RC5Remi Collet <remi@remirepo.net> - 7.2.0-0.29.RC4Remi Collet <remi@remirepo.net> - 7.2.0-0.28.RC4Remi Collet <remi@remirepo.net> - 7.2.0-0.27.RC3Remi Collet <remi@remirepo.net> - 7.2.0-0.26.RC3Remi Collet <remi@remirepo.net> - 7.2.0-0.25.RC3Remi Collet <remi@remirepo.net> - 7.2.0-0.24.RC2Remi Collet <remi@remirepo.net> - 7.2.0-0.23.RC2Remi Collet <remi@fedoraproject.org> - 7.2.0-0.22.RC1Remi Collet <remi@remirepo.net> - 7.2.0-0.21.RC1Remi Collet <remi@remirepo.net> - 7.2.0-0.19.20170827.c22cda5Remi Collet <remi@remirepo.net> - 7.2.0-0.18.20170828.cc57774Remi Collet <remi@remirepo.net> - 7.2.0-0.17.20170822.3fff74aRemi Collet <remi@remirepo.net> - 7.2.0-0.16.beta3Remi Collet <remi@remirepo.net> - 7.2.0-0.15.beta2Remi Collet <remi@remirepo.net> - 7.2.0-0.14.beta2Remi Collet <remi@remirepo.net> - 7.2.0-0.13.beta1Remi Collet <remi@remirepo.net> - 7.2.0-0.12.20170611.249f75eRemi Collet <remi@remirepo.net> - 7.2.0-0.11.alpha3Remi Collet <remi@remirepo.net> - 7.2.0-0.9.alpha2Remi Collet <remi@remirepo.net> - 7.2.0-0.8.alpha1Remi Collet <remi@remirepo.net> - 7.2.0-0.7.20170602.a86c87dRemi Collet <remi@remirepo.net> - 7.2.0-0.6.20170529.37a16a3Remi Collet <remi@remirepo.net> - 7.2.0-0.5.alpha0Remi Collet <remi@remirepo.net> - 7.2.0-0.4.20170516.0722a01Remi Collet <remi@remirepo.net> - 7.2.0-0.3.20170504.5af997eRemi Collet <remi@remirepo.net> - 7.2.0-0.2.20170424.eb68c0dRemi Collet <remi@remirepo.net> - 7.2.0-0.1.20170412.efeab78Remi Collet <remi@fedoraproject.org> - 7.1.4-1Remi Collet <remi@fedoraproject.org> - 7.1.4-0.1.RC1Remi Collet <remi@fedoraproject.org> - 7.1.3-1Remi Collet <remi@fedoraproject.org> - 7.1.3-0.2.RC1Remi Collet <remi@fedoraproject.org> - 7.1.3-0.1.RC1Remi Collet <remi@fedoraproject.org> - 7.1.2-1Remi Collet <remi@fedoraproject.org> - 7.1.2-0.2.RC1Remi Collet <remi@fedoraproject.org> 7.1.2-0.1.RC1Remi Collet <remi@fedoraproject.org> 7.1.1-3Remi Collet <remi@fedoraproject.org> 7.1.1�x��������������������X�
o �?l ka�W���0����y_file�$i����������������
y_z_x_
�h code not recurse while traversing a linked
  list, so it doesn't try to free an entries that have been removed.
  (bz #195723)
- Don't patch in a makefile, do it in the spec.- fix bug 191461: preserve ntp.conf local clock fudge statements
- fix bug 193047: both dhcp and dhclient need to ship common
                  man-pages: dhcp-options(5) dhcp-eval(5)- Make -R option take effect in per-interface client configs- fix bug 193047: allow $METRIC to be specified for dhclient routes
- add a '-R <request option list>' dhclient argument- fix a libdhcp4client memory leak (1 strdup) and 
  fill in client->packet.siaddr before bind_lease() for pump
  nextServer option.- Make libdhcp4client a versioned .so (BZ 192146)- Enable libdhcp4client build- Fix bug 191470: prevent dhcpd writing 8 byte dhcp-lease-time 
                  option in packets on 64-bit platforms- Add the libdhcp4client library package for use by the new libdhcp 
  package, which enables dhclient to be invoked by programs in a 
  single process from the library. The normal dhclient code is
  unmodified by this.- Add new dhclient command line argument:
  -V <vendor-class-identifier>- Upgrade to upstream version 3.0.4, released Friday 2006-05-05 .
- Add new dhclient command line arguments:
  -H <host-name> : parse as dhclient.conf 'send host-name "<host-name>";'
  -F <fqdn>      : parse as dhclient.conf 'send fqdn.fqdn "<fqdn>";'
  -T <timeout>   : parse as dhclient.conf 'timeout <timeout>;'- fix bug 181908: enable dhclient to operate on IBM zSeries z/OS linux guests:
  o add -I <dhcp-client-identifier> dhclient command line option
  o add -B "always broadcast" dhclient command line option
  o add 'bootp-broadcast-always;' dhclient.conf statement- Apply upstream fix for bug 176615 / ISC RT#15811- fix bug 181482: resolv.conf not updated on RENEW :
  since dhcp-3.0.1rc12-RHScript.patch: "$new_domain_servers" should have
  been "$new_domain_name_servers" :-(- bump again for double-long bug on ppc(64)- Rebuild for new gcc, glibc and glibc-kernheaders- Fix dhclient-script to use /bin/dbus-send now that all dbus related
  binaries are in /bin rather than /usr/bin- fix bug 177845: allow client ip-address as default router 
- fix bug 176615: fix DDNS update when Windows-NT client sends 
                  host-name with trailing nul- fix bug 176270: allow routers with an octet of 255 in their IP address- rebuilt- fix gcc 4.1 compile warnings (-Werror)- fix bug 173619: dhclient-script should reconfig on RENEW if 
                  subnet-mask, broadcast-address, mtu, routers, etc.
                  have changed
- apply upstream improvements to trailing nul options fix of bug 160655- Rebuild for FC-5
- fix bug 167028 - test IBM's unicast bootp patch (from xma@us.ibm.com)
- fix bug 171312 - silence chkconfig error message if ypbind not installed
- fix dhcpd.init when -cf arg given to dhcpd
- make dhcpd init touch /var/lib/dhcpd/dhcpd.leases, not /var/lib/dhcp/dhcpd.leases- Allow dhclient route metrics to be specified with DHCP options:
  The dhcp-options(5) man-page states:
  'option routers ... Routers should be listed in order of preference' 
  and
  'option static-routes ... are listed in descending order of priority' .
  No preference / priority could be set with previous dhclient-script .
  Now, dhclient-script provides: 
  Default Gateway (option 'routers') metrics:
    Instead of allowing only one default gateway, if more than one router 
    is specified in the routers option, routers following the first router
    will have a 'metric' of their position in the list (1,...N>1).
  Option static-routes metrics:
    If a target appears in the list more than once, routes for duplicate
    targets will have successively greater metrics, starting at 1.- further fix for bug 160655 / ISC bug 15293 - upstream patch:
  do NOT always strip trailing nulls in the dhcpd server
- handle static-routes option properly in dhclient-script :
  trailing 0 octets in the 'target' IP specify the class -
  ie '172.16.0.0 w.x.y.z' specifies '17�x�������������������X�
Bu�?D[sh��������������c576�$O����������������
���
�x AVC denials due to the "random" port usage.- Add fix for RedHat Bug #1164304 ("Upstream unit tests loads
  the installed shared libraries instead the ones from the build")- Update to krb5-1.13.2
  - drop patch for krb5-1.13.2-CVE_2015_2694_requires_preauth_bypass_in_PKINIT_enabled_KDC, fixed in krb5-1.13.2
  - drop patch for krb5-1.12.1-CVE_2014_5355_fix_krb5_read_message_handling, fixed in krb5-1.13.2
- Add script processing for upcoming Zanata l10n support
- Minor spec cleanup- fix for CVE-2015-2694 (#1216133) "requires_preauth bypass
  in PKINIT-enabled KDC".
  In MIT krb5 1.12 and later, when the KDC is configured with
  PKINIT support, an unauthenticated remote attacker can
  bypass the requires_preauth flag on a client principal and
  obtain a ciphertext encrypted in the principal's long-term
  key.  This ciphertext could be used to conduct an off-line
  dictionary attack against the user's password.- Add temporay workaround for RH bug #1204646 ("krb5-config
  returns wrong -specs path") which modifies krb5-config post
  build so that development of krb5 dependicies gets unstuck.
  This MUST be removed before rawhide becomes F23 ...- fix for CVE-2014-5355 (#1193939) "krb5: unauthenticated
  denial of service in recvauth_common() and others"- Update to krb5-1.13.1
  - drop patch for CVE_2014_5353_fix_LDAP_misused_policy_name_crash, fixed in krb5-1.13.1
  - drop patch for kinit -C loops (MIT/krb5 bug #243), fixed in krb5-1.13.1
  - drop patch for CVEs { 2014-9421, 2014-9422, 2014-9423, 2014-5352 }, fixed in krb5-1.13.1
- Minor spec cleanup- fix for CVE-2014-5352 (#1179856) "gss_process_context_token()
  incorrectly frees context (MITKRB5-SA-2015-001)"
- fix for CVE-2014-9421 (#1179857) "kadmind doubly frees partial
  deserialization results (MITKRB5-SA-2015-001)"
- fix for CVE-2014-9422 (#1179861) "kadmind incorrectly
  validates server principal name (MITKRB5-SA-2015-001)"
- fix for CVE-2014-9423 (#1179863) "libgssrpc server applications
  leak uninitialized bytes (MITKRB5-SA-2015-001)"- Remove "python-sphinx-latex" and "tar" from the build requirements
  to fix build failures on F22 machines.
- Minor spec cleanup- Support KDC_ERR_MORE_PREAUTH_DATA_REQUIRED (RT#8063)- fix for kinit -C loops (#1184629, MIT/krb5 issue 243, "Do not
  loop on principal unknown errors").
- Added "python-sphinx-latex" to the build requirements
  to fix build failures on F22 machines.- fix for CVE-2014-5354 (#1174546) "krb5: NULL pointer
  dereference when using keyless entries"- fix for CVE-2014-5353 (#1174543) "Fix LDAP misused policy
  name crash"- Bump 1%{?dist} to 2%{?dist} to workaround RPM sort issue
  which would lead yum updates to treat the last alpha as newer
  than the final version.- Update from krb5-1.13-alpha1 to final krb5-1.13
- Removed patch for CVE-2014-5351 (#1145425) "krb5: current
  keys returned when randomizing the keys for a service principal" -
  now part of upstream sources
- Use patch for glibc |eventfd()| prototype mismatch (#1147887) only
  for Fedora > 20- fix build failure caused by change of prototype for glibc
  |eventfd()| (#1147887)- fix for CVE-2014-5351 (#1145425) "krb5: current keys returned when
  randomizing the keys for a service principal"- fix the problem where the %license file has been a dangling symlink- kpropd hasn't bothered with -S since 1.11; stop trying to use that flag
  in the systemd unit file- update to 1.13 alpha1
  - drop upstreamed and backported patches- pull in upstream fix for an incorrect check on the value returned by a
  strdup() call (#1132062)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- update to 1.12.2
  - drop patch for RT#7820, fixed in 1.12.2
  - drop patch for #231147, fixed as RT#3277 in 1.12.2
  - drop patch for RT#7818, fixed in 1.12.2
  - drop patch for RT#7836, fixed in 1.12.2
  - drop patch for RT#7858, fixed in 1.12.2
  - drop patch for RT#7924, fixed in 1.12.2
  - drop patch for RT#7926, fixed in 1.12.2
  - drop patches for CVE-2014-4341/CVE-2014-4342, included in 1.12.2
  - drop patch�x��������������������X�
���?L�,@pp���(�����ОL�o@�$@����������������
ОϞў
�lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>Lenz Grimmer <lenz@mysql.com>MontyMontyMontyTim Smith <tim@mysql.com>David Axmark <davida@mysql.com>David Axmark <davida@mysql.com>David Axmark <davida@mysql.com>David Axmark <david@detron.se>David Axmark <david@detron.se>David Axmark <david@detron.se>- Added RocksDB- fix license field- Provide my.cnf for all systems- Include mysql-keyring directory
- Provide keyring_file.so plugin- Fix for centos6 to write temp pass into log file instead of stdout (#1541769)- Re-added TokuBackup to the packaging (JEN-439)- Initial release PS 5.7.10-1rc1- Updated for 5.7.9
- Added libtest_* plugins to test package subpackage
- Add mysqlpump man page
- Obsolete mysql-connector-c-shared dependencies- Add support for pkg-config- Added libtest_framework.so, libtest_services.so, libtest_services_threaded.so plugins
- Build and ship mecab plugin- Include boost sources
- Fix cmake buildrequires
- Fix build on el5 with gcc44
- Add license info in each subpackage
- Soname bump, more compat packages
- Updated default shell for mysql user
- Added mysql_ssl_rsa_setup
- Include mysql-files directory- Provide replication_observers_example_plugin.so plugin- Updated for 5.7.6- Provide mysql_no_login.so plugin- Provide mysql-compat-server dependencies- Remove perl(GD) and dtrace dependencies- Resolve embedded-devel conflict issue- Add bench package
- Enable dtrace- Updated for 5.7.5- Fix Cflags for el7- Support for enterprise packages
- Upgrade from MySQL-* packages- Resolve conflict with mysql-libs-compat- Resolve conflict issues during upgrade
- Add ha_example.so plugin which is now included- 5.7.4
- Enable shared libmysqld by cmake option
- Move mysqltest and test plugins to test subpackage- Fixed isa_bits error- Initial 5.7 port- Fixed uln advanced rpm libyassl.a error
- Updated to 5.6.15- Fixed mysql_install_db usage 
- Improved handling of plugin directory- Refresh mysql-install patch and service renaming- Updated to 5.6.14- Support upgrade from 5.5 ULN packages to 5.6- Enhanced perl filtering 
- Added openssl-devel to buildreq- Removed mysql_embedded binary to resolve multilib conflict issue- Fixed Provides and Obsoletes issues in server, test packages- Updated to 5.6.13- Added files list to embedded packages- Updated libmysqld.a with libmysqld.so in embedded package- Updated test package dependency from client to server- Added libs-compat dependency under libs package to resolve server
  installation conflicts issue.- Removed libmysqlclient.so.16 from libs package- Adjusted to work on OEL6- Move libs to mysql/
- Basic multi arch support
- Fix changelog dates- Major cleanup- Updated to 5.6.12- Allow to override the default to use the bundled yaSSL by an option like
      --define="with_ssl /path/to/ssl"- Replace old my-*.cnf config file examples with template my-default.cnf- Let the installation use the new option "--random-passwords" of "mysql_install_db".
  (Bug# 12794345 Ensure root password)
- Fix an inconsistency: "new install" vs "upgrade" are told from the (non)existence
  of "$mysql_datadir/mysql" (holding table "mysql.user" and other system stuff).- Add a macro "runselftest":
  if set to 1 (default), the test suite will be run during the RPM build;
  this can be oveeridden via the command line by adding
      --define "runselftest 0"
  Failures of the test suite will NOT make the RPM build fail!- Add the man page for the "mysql_config_editor".- Make sure newly added "SPECIFIC-ULN/" directory does not disturb packaging.- Removal all traces of the readline library from mysql (BUG 13738013)- Fix duplicate mentioning of "mysql_plugin" and its manual page,
  it is better to keep alphabetic order in the files list (merging!).- Let the RPM capabilities ("obsoletes" etc) ensure that an upgrade may replace
  the RPMs of any configuration (of the current or the preceding release series)
  by the ne�x��������������������X�
 t�?flec�������������x se�$H����������������
���
�- override the default build rules to not delete temporary y.tab.c files,
  so that they can be packaged, allowing debuginfo files which point to them
  do so usefully (#729044)- build shared libraries with partial RELRO support (#723995)
- filter out potentially multiple instances of -Wl,-z,relro from krb5-config
  output, now that it's in the buildroot's default LDFLAGS
- pull in a patch to fix losing track of the replay cache FD, from SVN by
  way of Kevin Coffman- kadmind.init: drop the attempt to detect no-database-present errors (#723723),
  which is too fragile in cases where the database has been manually moved or
  is accessed through another kdb plugin- backport fixes to teach libkrb5 to use descriptors higher than FD_SETSIZE
  to talk to a KDC by using poll() if it's detected at compile-time (#701446,
  RT#6905)- pull a fix from SVN to try to avoid triggering a PTR lookup in getaddrinfo()
  during krb5_sname_to_principal(), and to let getaddrinfo() decide whether or
  not to ask for an IPv6 address based on the set of configured interfaces
  (#717378, RT#6922)
- pull a fix from SVN to use AI_ADDRCONFIG more often (RT#6923)- apply upstream patch by way of Burt Holzman to fall back to a non-referral
  method in cases where we might be derailed by a KDC that rejects the
  canonicalize option (for example, those from the RHEL 2.1 or 3 era) (#715074)- pull a fix from SVN to get libgssrpc clients (e.g. kadmin) authenticating
  using the old protocol over IPv4 again (RT#6920)- incorporate a fix to teach the file labeling bits about when replay caches
  are expunged (#576093)- switch to the upstream patch for #707145- klist: don't trip over referral entries when invoked with -s (#707145,
  RT#6915)- fixup URL in a comment
- when built with NSS, require 3.12.10 rather than 3.12.9- update to 1.9.1:
  - drop no-longer-needed patches for CVE-2010-4022, CVE-2011-0281,
    CVE-2011-0282, CVE-2011-0283, CVE-2011-0284, CVE-2011-0285- kadmind: add upstream patch to fix free() on an invalid pointer (#696343,
  MITKRB5-SA-2011-004, CVE-2011-0285)- don't discard the error code from an error message received in response
  to a change-password request (#658871, RT#6893)- override INSTALL_SETUID at build-time so that ksu is installed into
  the buildroot with the right permissions (part of #225974)- backport change from SVN to fix a computed-value-not-used warning in
  kpropd (#684065)- turn off NSS as the backend for libk5crypto for now to work around its
  DES string2key not working (#679012)
- add revised upstream patch to fix double-free in KDC while returning
  typed-data with errors (MITKRB5-SA-2011-003, CVE-2011-0284, #674325)- throw in a not-applied-by-default patch to try to make pkinit debugging
  into a run-time boolean option named "pkinit_debug"- turn on NSS as the backend for libk5crypto, adding nss-devel as a build
  dependency when that switch is flipped- krb5kdc init script: prototype some changes to do a quick spot-check
  of the TGS and kadmind keys and warn if there aren't any non-weak keys
  on file for them (to flush out parts of #651466)- add upstream patches to fix standalone kpropd exiting if the per-client
  child process exits with an error (MITKRB5-SA-2011-001), a hang or crash
  in the KDC when using the LDAP kdb backend, and an uninitialized pointer
  use in the KDC (MITKRB5-SA-2011-002) (CVE-2010-4022, #664009,
  CVE-2011-0281, #668719, CVE-2011-0282, #668726, CVE-2011-0283, #676126)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- fix a compile error in the SELinux labeling patch when -DDEBUG is used (Sumit
  Bose)- properly advertise that the kpropd init script now supports force-reload
  (Zbysek Mraz, #630587)- pkinit: when verifying signed data, use the CMS APIs for better
  interoperability (#636985, RT#6851)- update to 1.9 final- fix link flags and permissions on shared libraries (ausil)- update to 1.9 beta 3- update to 1.9 beta 2- drop not-needed-since-1.8 build dependency on rsh (ssorce)- start moving to 1.9 with beta 1
�x�������������p������X�
tp�?fedo�y������Xs�������_hang�$����������������
�_�_�_
�ddr replace/- 4.3.2b1- send unicast request/release via correct interface (#800561, #1177351)- rebuild against bind-9.10.2rc1- rebuild against bind 9.10.1-P1- dhclient: write DUID_LLT even in stateless mode (#1156356)- option 97 - pxe-client-id (#1058674)- amend post scriptlets for #1120656- dhclient-script: restorecon calls shouldn't be needed
                   as we have SELinux transition rules (#1161500)- GSSAPI support for ldap authentication (#1150542)- redefine DHCLIENT_DEFAULT_PREFIX_LEN  64 -> 128- Relay-forward Message's Hop Limit should be 32 (#1147240)- dhcpd generates spurious responses when seeing requests
  from vlans on plain interface (#1150587)- rebuild against bind-9.9.6- [dhclient -6] infinite preferred/valid lifetime represented as -1 (#1133839)- better obsoletes for server & client- Fix dhclient obsoletes version- dhclient-script: another improvement of add_ipv6_addr_with_DAD()- spec: use -D with 'install'
- dhclient-script: IPv6 address which fails DAD is auto-removed when it was
  added with valid_lft/preferred_lft other then 'forever' (#1133465)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- dhclient-script: one more fix for #1129500- dhclient-script: PREINIT6: make sure link-local address is available (#1129500)- 4.3.1- dhclient-script: it's OK if the arping reply comes from our system (#1116004)- Use network-online.target instead of network.target (#1120656)- fix license handling- 4.3.1b1- dhclient-script: fix issue with classless static routes that breaks Fedora 20 on GCE cloud (#1102830)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- systemtap: fixed dtrace input file (#1102797)- dhcp-sd_notify.patch BuildRequires: pkgconfig(libsystemd)- dhclient-script: fix stateless DHCPv6 mode (#1101149)- use StandardError=null instead of log_perror.patch- support for sending startup notifications to systemd (#1077666)- rename doc subpackage do devel-doc- added 'doc' package containing doxygen-generated documentation- dhclient: rename our -I option to -C as upstream now uses -I- dhclient-script: don't flush all addresses, just the used one- IPoIB: add GUID/DUID to dhcpd logs (#1064416)- don't try to run tests because there's no atf package since F21- turn on using of DUID with DHCPv4 clients (#560361,c#40)
- remove default /etc/dhcp/dhclient.conf- 4.3.0- 4.3.0rc1- don't apply retransmission.patch for now (RHBZ#1026565)- Rebuild for new bind- 4.3.0b1
- ship dhcp-lease-list.pl
- dhclient-script: don't ping router (#1055181)- update address lifetimes on RENEW/RENEW6 (#1032809)- make it actually build- 4.3.0a1: requires bind-9.9.5- dhclient-script: set address lifetimes (#1032809)- dhclient-script(RENEW6|REBIND6): delete old ip6_address if it changed (#1015729)- Provide default /etc/dhcp/dhclient.conf
- Client always sends dhcp-client-identifier (#560361)- use upstream patch for #1001742 ([ISC-Bugs #34784])- dhcpd rejects the udp packet with checksum=0xffff (#1015997)- 'No subnet declaration for <iface>' should be info, not error
- decrease the sleep in 12-dhcpd due to timeout (#1003695#8)- fix segfault introduced with previous commit- 12-dhcpd: wait a few seconds before restarting services (#1003695)
- another solution for #1001742 (#1005814#c10)- bind DHCPv6 client to link-local address instead of 0 address (#1001742)- don't crash on aliased infiniband interface (#996518)- BuildRequires: systemd due to  %{_unitdir}- 12-dhcpd previously exited with error status 1 (#989207)- rebuild against new bind- fix several memory leaks in omapi (#978420)
- remove send_release.patch (#979510)- rebuilt against bind once more- return /etc/sysconfig/dhcpd back, but do NOT use it (#909733)- rebuild against new bind- add missing conversion specifier in log_fatal() call (#957371)- rebuild against new bind- Expose next-server DHCPv4 option to dhclient script- describe -user/-group/-chroot in dhcpd.8- remove triggerun condition (#895475)- Rebuilt for https://fedoraproject.org/wiki/Fedora_1�x�������������������X�
x)�? 1.0((������������� Uni�$t����������������
���
� 1.4.2-2Nalin Dahyabhai <nalin@redhat.com> 1.4.2-1Nalin Dahyabhai <nalin@redhat.com> 1.4.1-6Nalin Dahyabhai <nalin@redhat.com> 1.4.1-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.4.1-4Nalin Dahyabhai <nalin@redhat.com> 1.4.1-3Martin Stransky <stransky@redhat.com> 1.4.1-2Nalin Dahyabhai <nalin@redhat.com> 1.4.1-1Nalin Dahyabhai <nalin@redhat.com> 1.4-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.4-2Nalin Dahyabhai <nalin@redhat.com> 1.4-1Nalin Dahyabhai <nalin@redhat.com> 1.3.6-3Nalin Dahyabhai <nalin@redhat.com> 1.3.6-2Nalin Dahyabhai <nalin@redhat.com> 1.3.6-1Nalin Dahyabhai <nalin@redhat.com> 1.3.5-8Martin Stransky <stransky@redhat.com> 1.3.5-7Nalin Dahyabhai <nalin@redhat.com> 1.3.5-6Nalin Dahyabhai <nalin@redhat.com> 1.3.5-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.5-2Nalin Dahyabhai <nalin@redhat.com> 1.3.5-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.4-7Nalin Dahyabhai <nalin@redhat.com> 1.3.4-6Nalin Dahyabhai <nalin@redhat.com> 1.3.4-5Nalin Dahyabhai <nalin@redhat.com> 1.3.4-4Nalin Dahyabhai <nalin@redhat.com> 1.3.4-3Nalin Dahyabhai <nalin@redhat.com> 1.3.4-2Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.4-0.1Nalin Dahyabhai <nalin@redhat.com> 1.3.4-0Nalin Dahyabhai <nalin@redhat.com> 1.3.3-8Nalin Dahyabhai <nalin@redhat.com> 1.3.3-7Nalin Dahyabhai <nalin@redhat.com> 1.3.3-6Nalin Dahyabhai <nalin@redhat.com> 1.3.3-5Nalin Dahyabhai <nalin@redhat.com> 1.3.3-4Thomas Woerner <twoerner@redhat.com> 1.3.3-3Nalin Dahyabhai <nalin@redhat.com> 1.3.3-2Nalin Dahyabhai <nalin@redhat.com> 1.3.3-1Nalin Dahyabhai <nalin@redhat.com> 1.3.2-1Nalin Dahyabhai <nalin@redhat.com> 1.3.1-12Elliot Lee <sopwith@redhat.com> 1.3.1-11.1Elliot Lee <sopwith@redhat.com> 1.3.1-11Nalin Dahyabhai <nalin@redhat.com> 1.3.1-10Nalin Dahyabhai <nalin@redhat.com> 1.3.1-9Nalin Dahyabhai <nalin@redhat.com> 1.3.1-8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.1-7Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.1-6Nalin Dahyabhai <nalin@redhat.com> 1.3.1-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.1-4Dan Walsh <dwalsh@redhat.com> 1.3.1-3Nalin Dahyabhai <nalin@redhat.com> 1.3.1-2Nalin Dahyabhai <nalin@redhat.com> 1.3.1-1Nalin Dahyabhai <nalin@redhat.com> 1.3.1-0Nalin Dahyabhai <nalin@redhat.com> 1.3-2Nalin Dahyabhai <nalin@redhat.com> 1.3-1Nalin Dahyabhai <nalin@redhat.com> 1.2.8-4Nalin Dahyabhai <nalin@redhat.com> 1.3-0.beta.4Elliot Lee <sopwith@redhat.com>Jeremy Katz <katzj@redhat.com> 1.2.8-2Nalin Dahyabhai <nalin@redhat.com> 1.2.8-1Nalin Dahyabhai <nalin@redhat.com> 1.2.7-14Nalin Dahyabhai <nalin@redhat.com> 1.2.7-13Nalin Dahyabhai <nalin@redhat.com> 1.2.7-12Nalin Dahyabhai <nalin@redhat.com> 1.2.7-11Nalin Dahyabhai <nalin@redhat.com> 1.2.7-10Nalin Dahyabhai <nalin@redhat.com> 1.2.7-9Nalin Dahyabhai <nalin@redhat.com> 1.2.7-8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.7-7Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.7-5Bill Nottingham <notting@redhat.com> 1.2.7-4Jeremy Katz <katzj@redhat.com> 1.2.7-3Jakub Jelinek <jakub@redhat.com> 1.2.7-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.7-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.6-5Nalin Dahyabhai <nalin@redhat.com> 1.2.6-4Nalin Dahyabhai <nalin@redhat.com> 1.2.6-3Nalin Dahyabhai <nalin@redhat.com> 1.2.6-2Nalin Dahyabhai <nalin@redhat.com> 1.2.6-1Nalin Dahyabhai <nalin@redhat.com> 1.2.5-7Nalin Dahyabhai <nalin@redhat.com> 1.2.5-6Nalin Dahyabhai <nalin@redhat.com> 1.2.5-5Jakub Jelinek <jakub@redhat.com> 1.2.5-4Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.5-1Nalin Dahyabhai <nalin@redhat.com> 1.2.4-1Nalin Dahyabhai <nalin@redhat.com> 1.2.3-5Florian La Roche <Florian.LaRoche@redhat.de>Na�x�������������`������X�
xm�?e (i���������������)- �$^����������������
���
�add one for kpropd- make sure workstation servers are all disabled by default
- clean up krb5server init script- apply second set of buffer overflow fixes from Tom Yu
- fix from Dirk Husung for a bug in buffer cleanups in the test suite
- work around possibly broken rev binary in running test suite
- move default realm configs from /var/kerberos to %{_var}/kerberos- make ksu and v4rcp owned by root- use %{_infodir} to better comply with FHS
- move .so files to -devel subpackage
- tweak xinetd config files (bugs #11833, #11835, #11836, #11840)
- fix package descriptions again- change a LINE_MAX to 1024, fix from Ken Raeburn
- add fix for login vulnerability in case anyone rebuilds without krb4 compat
- add tweaks for byte-swapping macros in krb.h, also from Ken
- add xinetd config files
- make rsh and rlogin quieter
- build with debug to fix credential forwarding
- add rsh as a build-time req because the configure scripts look for it to
  determine paths- fix config_subpackage logic- remove setuid bit on v4rcp and ksu in case the checks previously added
  don't close all of the problems in ksu
- apply patches from Jeffrey Schiller to fix overruns Chris Evans found
- reintroduce configs subpackage for use in the errata
- add PreReq: sh-utils- fix double-free in the kdc (patch merged into MIT tree)
- include convert-config-files script as a documentation file- patch ksu man page because the -C option never works
- add access() checks and disable debug mode in ksu
- modify default ksu build arguments to specify more directories in CMD_PATH
  and to use getusershell()- fix configure stuff for ia64- add LDCOMBINE=-lc to configure invocation to use libc versioning (bug #10653)
- change Requires: for/in subpackages to include %{version}- add man pages for kerberos(1), kvno(1), .k5login(5)
- add kvno to -workstation- Merge krb5-configs back into krb5-libs.  The krb5.conf file is marked as
  a %config file anyway.
- Make krb5.conf a noreplace config file.- Make klogind pass a clean environment to children, like NetKit's rlogind does.- Don't enable the server by default.
- Compress info pages.
- Add defaults for the PAM module to krb5.conf- Correct copyright: it's exportable now, provided the proper paperwork is
  filed with the government.- apply Mike Friedman's patch to fix format string problems
- don't strip off argv[0] when invoking regular rsh/rlogin- run kadmin.local correctly at startup- pass absolute path to kadm5.keytab if/when extracting keys at startup- fix info page insertions- tweak server init script to automatically extract kadm5 keys if
  /var/kerberos/krb5kdc/kadm5.keytab doesn't exist yet
- adjust package descriptions- fix for potentially gzipped man pages- fix comments in krb5-configs- move /usr/kerberos/bin to end of PATH- install kadmin header files- patch around TIOCGTLC defined on alpha and remove warnings from libpty.h
- add installation of info docs
- remove krb4 compat patch because it doesn't fix workstation-side servers- remove hesiod dependency at build-time- rebuild on 1.1.1- clean up init script for server, verify that it works [jlkatz]
- clean up rotation script so that rc likes it better
- add clean stanza- backed out ncurses and makeshlib patches
- update for krb5-1.1
- add KDC rotation to rc.boot, based on ideas from Michael's C version- added -lncurses to telnet and telnetd makefiles- added krb5.csh and krb5.sh to /etc/profile.d- broke out configuration files- fixed server package so that it works now- started changelog (previous package from zedz.net)
- updated existing 1.0.5 RPM from Eos Linux to krb5 1.0.6
- added --force to makeinfo commands to skip errors during build













	

������1.18.2-32.el8_101.18.2-32.el8_10

.build-id889feba1c1cc1ce3fec20aea047ed966c06ff181fc182d950c58c178357f4d6407025306c7c19e82libkadm5clnt.solibkadm5clnt�x��������������~�����X�
bp�?ges,@b������h������4yout�${����������������
�4�4
�Y
�0?
��d
�
�
�"
�	+
�	h
�
�
�D
�H
�U
��
�	
�4
�L
�R
�Y
�

P
�
8
�P
�	\
�
"h
�(�
�Y�
�
l,
�rD
�y�
���
��
����`]��]�*]�����!(�%
8�,�9���:���=
a
>
i
?
q
@
y
B
�
F
�
G
�
�H
�
�I
�
�X
|Y
�Z
�
[
�
\
�
�]

�^
7�wb
C�
d
D�
e
D�
f
D�
l
D�
t
E
�u
K(
�v
Q@ew
��
�x
��
�y
�� 
�<
�
��
�
�i
�
�q
�
�|
�
��
�
��
�
��



��


��

��

�


�.


�W
�
��


��
�
�$
g
�(
h
�,
CPercona-Server-server-575.7.3235.1.el8Percona Server: a very fast and reliable SQL database serverThe Percona Server software delivers a very fast, multi-threaded, multi-user,
and robust SQL (Structured Query Language) database server. Percona Server
is intended for mission-critical, heavy-load production systems.

Percona recommends that all production deployments be protected with a support
contract (http://www.percona.com/mysql-suppport/) to ensure the highest uptime,
be eligible for hot fixes, and boost your team's productivity.

This package includes the Percona Server with XtraDB binary
as well as related utilities to run and administer Percona Server.

If you want to access and work with the database, you have to install
package "Percona-Server-client-57" as well!_���minimal-centos-8-x64-2265.ci.percona.com	F�Percona, IncCopyright (c) 2000, 2015, Oracle and/or its affiliates. All rights reserved. Under the GNU General Public License (http://www.gnu.org/licenses/).Percona MySQL Development Team <mysqldev@percona.com>Applications/Databaseshttp://www.percona.com/linuxx86_64/usr/sbin/groupadd -g 27 -o -r mysql >/dev/null 2>&1 || :
/usr/sbin/useradd -M -N -g mysql -o -r -d /var/lib/mysql -s /bin/false \
    -c "Percona Server" -u 27 mysql >/dev/null 2>&1 || :
if [ "$1" = 1 ]; then
  if [ -f /etc/my.cnf ]; then
    timestamp=$(date '+%Y%m%d-%H%M')
    cp /etc/my.cnf \
    /etc/my.cnf.rpmsave-${timestamp}
  fi
fidatadir=$(/usr/bin/my_print_defaults server mysqld | grep '^--datadir=' | sed -n 's/--datadir=//p' | tail -n 1)
/bin/chmod 0751 "$datadir" >/dev/null 2>&1 || :
if [ ! -e /var/log/mysqld.log ]; then
    /usr/bin/install -m0640 -omysql -gmysql /dev/null /var/log/mysqld.log
fi
#/bin/touch /var/log/mysqld.log >/dev/null 2>&1 || :
  
if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset mysqld.service &>/dev/null || : 
fi 

  if [ $1 == 1 ]; then
      /usr/bin/systemctl enable mysqld >/dev/null 2>&1 || :
  fi

  MYCNF_PACKAGE="mariadb-libs"

if [ -e /etc/my.cnf ]; then
  MYCNF_PACKAGE=$(rpm -qi `rpm -qf /etc/my.cnf` | grep -m 1 Name | awk '{print $3}')
fi
if [ "$MYCNF_PACKAGE" == "mariadb-libs" -o "$MYCNF_PACKAGE" == "mysql-libs" -o "$MYCNF_PACKAGE" == "Percona-Server-server-57" ]; then
  MODIFIED=$(rpm -Va "$MYCNF_PACKAGE" | grep '/etc/my.cnf' | awk '{print $1}' | grep -c 5)
  if [ "$MODIFIED" == 1 ]; then
      cp /etc/my.cnf /etc/my.cnf.old
  fi
else
  cp /etc/my.cnf /etc/my.cnf.old
fi
if [ ! -f /etc/my.cnf ]; then
  rm -rf /etc/my.cnf
  update-alternatives --install /etc/my.cnf my.cnf "/etc/percona-server.cnf" 200
else
  if [�x�������������Pn�����X�
�?�A�����������a��$q����������������
a�b�`�
�d1a6615b539ee99b408fa19fe0a030f9a243e38a1f36a1253b35632a72fd1dd0b97f024da3927cc64dc55fd7d1e2bc9bd2197777d61a9dbc99877c7859793e7298e2a7e418b0285c945bca29dbfbd30a4de6316f6a914a53318ab3a8d79697e396b51d2b9a3b87fafdb540298792a70676b340572ee217a6342c290f866ad094e1675627f5fe3db5d16bc3bbb0a9c0207bc039f104ec253c2e617999558f1f6376a723e5f4ed99a7360fa3491cd34498243a3c2c8c3c5ae8926303d2964d613da828b70119f8a13c1086902af921176e53c13e6ae972342fcae5cb832f09e0879619149a6bf816b1d896aaccb428fa8c3c6f41c9a43cc016f6b213d55888724295e1e1d435ba643bf567ac702fb0ec9170fad1059b84910080eb1778dca25df82203b7eab6cb86589bd5cafdd5305928029be2f5944205e146d677e536aa546a2f1d5f3b4cd3c91d73daf4fc8d95e08c1e18eda23921d8a021dd0517eb198ce96df1748dc55a5dce8066504e8f4da01c16710f613d745a30aee769ecf2b8b6a9f066afed2a2b7aa7013987f6c19c5aa9d2cdc9a8e7fa24a36ee598eacee3bc6644e72061e777a1a2625198f9cf3d8607562353d0f9e0eb51119865df720ac14da9dace4d905533c672b2f3b9a5743be5ea4f721c2f51b3285cbc854184deb32081dea1e005ca0559f656c18042dc9f55f25d1da12c0547b1eeb672d500c5d52af83dd29e734b34f3f8cb4a8c2b9305b6e7f378214ecd13928f2671db2c7ee0f7b3782888351f954558afccbda5c11b9bf40b6f7ae1db8cc2c2d5c6a1b467398db9cfc6f61acc5a4d22aed2083accd2cecd8cbe42184dcb4553b5a460ceb79a210f3f92adf3cf516747616fbe142306be804c8a7a6da49b85e0e1763d0aa4465f9fb641b4c17628150a4ab3aa614f44d8a29c5d5268eb4f2a151e5164a04a3ce0e729daaf859131ca68620f86390d1133b04a5b0fd18071e35fe4a73f7d5ecb1a837a7ec7ad874d87892a12f880e4abbf7936455305c830e827911ad9422b85250ad54b5a63bee6cad8cb57f71a63f0b2882b96f86a62a86e150e29c103e81e7540c5d108769c5dbb8a969a86ac275570201b8c26b576d5da0c27afbcce3e9f91c06epython2.7-configlibpython2.7.so.1.0python2.pcpython-2.7.pc../../libpython2.7.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpython2-2.7.18-17.module+el8.10.0+1813+4b021305.rocky.0.2.src.rpm������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������pkgconfig(python)pkgconfig(python-2.7)pkgconfig(python2)python2-develpython2-devel(x86-64)@@@@







/bin/sh/usr/bin/p�x��������������]�����X�
<n?@redHj������0t����ؐ Dah�$H����������������
ؐאِ
�umpslow,
  mysql_fix_privilege_tables.1), removed "-n" from install section.- removed the GIF Icon (file was not included in the sources anyway)
- removed unused variable shared_lib_version
- do not run automake before building the standard binary
  (should not be necessary)
- add server suffix '-standard' to standard binary (to be in line
  with the binary tarball distributions)
- Use more RPM macros (_exec_prefix, _sbindir, _libdir, _sysconfdir,
  _datadir, _includedir) throughout the spec file.
- allow overriding CC and CXX (required when building with other compilers)- re-enabled RAID again- disabled MyISAM RAID (--with-raid)- it throws an assertion which
  needs to be investigated first.- added missing file mysql_secure_installation to server subpackage
  (BUG 141)- re-added missing pre- and post(un)install scripts to server subpackage
- added config file /etc/my.cnf to the file list (just for completeness)
- make sure to create the datadir with 755 permissions- removed unusedql.com>

- Reworked the build steps a little bit: the Max binary is supposed
  to include OpenSSL, which cannot be linked statically, thus trying
  to statically link against a special glibc is futile anyway
- because of this, it is not required to make yet another build run
  just to compile the shared libs (saves a lot of time)
- updated package description of the Max subpackage
- clean up the BuildRoot directory afterwards- Updated Packager information
- Fixed the build options: the regular package is supposed to
  include InnoDB and linked statically, while the Max package
  should include BDB and SSL support- Use more RPM macros (e.g. infodir, mandir) to make the spec
  file more portable
- reorganized the installation of documentation files: let RPM
  take care of this
- reorganized the file list: actually install man pages along
  with the binaries of the respective subpackage
- do not include libmysqld.a in the devel subpackage as well, if we
  have a special "embedded" subpackage
- reworked the package descriptions- Added embedded server as a separate RPM- Added mysqld-max to the distribution- Added mysql-test to the bench package- Added separate libmysql_r directory; now both a threaded
  and non-threaded library is shipped.- Added the support-files/my-example.cnf to the docs directory.

- Removed devel dependency on base since it is about client
  development.- Cleaned up some for 3.23.- Added support for shared libraries in a separate sub
  package. Original fix by David Fox (dsfox@cogsci.ucsd.edu)

- The --enable-assembler switch is now automatically disables on
  platforms there assembler code is unavailable. This should allow
  building this RPM on non i386 systems.- Removed unportable cc switches from the spec file. The defaults can
  now be overridden with environment variables. This feature is used
  to compile the official RPM with optimal (but compiler version
  specific) switches.

- Removed the repetitive description parts for the sub rpms. Maybe add
  again if RPM gets a multiline macro capability.

- Added support for a pt_BR translation. Translation contributed by
  Jorge Godoy <jorge@bestway.com.br>.- A lot of changes in all the rpm and install scripts. This may even
  be a working RPM :-)- A developers changelog for MySQL is available in the source RPM. And
  there is a history of major user visible changed in the Reference
  Manual.  Only RPM specific changes will be documented here.minimal-centos-6-x32-2258 1606088872







































	

 !"#$%&'5.7.32-35.1.el85.7.32-35.1.el8
	

�x�������������@M�����X�
�?F��������`����o�$!����������������
�o�o�o
����rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibxcrypt-4.1.1-6.el8.src.rpm����������������������������������������������������������������libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.2.5)(64bit)libcrypt.so.1(XCRYPT_2.0)(64bit)libxcryptlibxcrypt(x86-64)@@@@@@







@glibc(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)2.26.9000-463.0.4-14.6.0-14.0-15.2-14.14.3`���`m��[j�@[j�@[j�@[a��[H�@[H�@[H�@[H�@[6@[6@Z�@Z�@Zz�@Zs
@Zq��Zli�Ze�@Zc/@Zc/@Zc/@ZX�@ZV@ZT��Stanislav Zidek <szidek@redhat.com> - 4.1.1-6Stanislav Zidek <szidek@redhat.com> - 4.1.1-5Florian Weimer <fweimer@redhat.com> - 4.1.1-4Florian Weimer <fweimer@redhat.com> - 4.1.1-3Florian Weimer <fweimer@redhat.com> - 4.1.1-2Björn Esser <besser82@fedoraproject.org> - 4.1.1-1Björn Esser <besser82@fedoraproject.org> - 4.1.0-1Björn Esser <besser82@fedoraproject.org> - 4.0.1-6Björn Esser <besser82@fedoraproject.org> - 4.0.1-5Fedora Release Engineering <releng@fedoraproject.org> - 4.0.1-4Florian Weimer <fweimer@redhat.com> - 4.0.1-3Florian Weimer <fweimer@redhat.com> - 4.0.1-2Björn Esser <besser82@fedoraproject.org> - 4.0.1-1Björn Esser <besser82@fedoraproject.org> - 4.0.0-5Fedora Release Engineering <releng@fedoraproject.org> - 4.0.0-4Björn Esser <besser82@fedoraproject.org> - 4.0.0-3Björn Esser <besser82@fedoraproject.org> - 4.0.0-2Björn Esser <besser82@fedoraproject.org> - 4.0.0-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4.0.0-0.204.20180120git3436e7bBjörn Esser <besser82@fedoraproject.org> - 4.0.0-0.203.20180120git3436e7bBjörn Esser <besser82@fedoraproject.org> - 4.0.0-0.202.20180120gitde99d27Björn Esser <besser82@fedoraproject.org> - 4.0.0-0.201.20171109git15447aaBjörn Esser <besser82@fedoraproject.org> - 4.0.0-0.200.20171109git15447aaBjörn Esser <besser82@fedoraproject.org> - 4.0.0-0.101.20171109git15447aaBjörn Esser <besser82@fedoraproject.org> - 4.0.0-0.100.git20171109.15447aa+ libxcrypt-4.1.1-6
- Rebuilt with fixed binutils (#1954438)- Fixed salt interoperability issue (#1899716)- Move development panpages to libxcrypt-devel (#1613824)- Change crypt, crypt_r to return NULL on failure (#1613537)- Add manpages aliases for crypt, crypt_r, crypt_ra (#1612157)- New upstream release- New upstream release- Make testsuite fail on error again
- Update patch0 with more upstream fixes- Add patch to update to recent development branch
- Re-enable SUNMD5 support as it is BSD licensed now
- Build compatibility symbols for glibc only
- Skip failing testsuite once- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Remove CDDL from license list (#1592445)- Remove SUNMD5 support (#1592445)- New upstream release- Switch to %ldconfig_scriptlets- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Add patch to fix unintialize value in badsalt test- Add patch to fix bcrypt test with GCC8- New upstream release- Fix Obsoletes- Update to new snapshot fixing cast-align- Update to new snapshot (rhbz#1536752)- Use archful Obsoletes for libcrypt
- Add versioned Requires on glibc packages not shipping libcrypt
- Add comments about the packaging logic for replacing former libcrypt- Initial import (rhbz#1532794)
- Add Obsoletes/Provides for libcrypt- Fix style of %git_{rel,ver}- Initial rpm release (rhbz#1532794)
- Start revision at 0.100 to superseed builds from COPR
















	

���4.1.1-6.el84.1.1-6.el8
.lib�x��������������<�����X�
.2c?3Ka�����������������dhat�$-����������������
������
�* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php4






























































	

 !"#$%&'()*+,-./0123456789:;<=>5.297.3.33-11.el8.remi20180731-647.3.337.3.3320180731-647.3.33-11.el8.remi7.3.33-11.el8.remi7.3.337.3.337.3.337.3.337.3.337.3.33











	

php.d20-bz2.ini20-calendar.ini20-ctype.ini20-curl.ini20-exif.ini20-fileinfo.ini20-ftp.ini20-gettext.ini20-iconv.ini20-phar.ini20-sockets.ini20-tokenizer.iniphp.iniphpmodulesbz2.socalendar.soctype.socurl.soexif.sofileinfo.softp.sogettext.soiconv.sophar.sosockets.sotokenizer.sopeclphp73-php-commonCODING_STANDARDSCREDITSEXTENSIONSNEWSREADME.EXT_SKELREADME.GIT-RULESREADME.MAILINGLIST_RULESREADME.NEW-OUTPUT-APIREADME.PARAMETER_PARSING_APIREADME.REDIST.BINSREADME.RELEASE_PROCESSREADME.SELF-CONTAINED-EXTENSIONSREADME.STREAMSREADME.SUBMITTING_PATCHREADME.TESTINGREADME.UNIX-BUILD-SYSTEMREADME.WIN32-BUILD-SYSTEMREADME.input_filterREADME.mdphp.ini-developmentphp.ini-productionphp73-php-commonLICENSETSRM_LICENSEZEND_LICENSElibmagic_LICENSEtimelib_LICENSEphptestspeclphppeclxml/etc/opt/remi/php73//etc/opt/remi/php73/php.d//opt/remi/php73/root/usr/lib64//opt/remi/php73/root/usr/lib64/php//opt/remi/php73/root/usr/lib64/php/modules//opt/remi/php73/root/usr/share/doc//opt/remi/php73/root/usr/share/doc/php73-php-common//opt/remi/php73/root/usr/share/licenses//opt/remi/php73/root/usr/share/licenses/php73-php-common//opt/remi/php73/root/usr/share//opt/remi/php73/root/usr/share//opt/remi/php73/root/usr/share/tests//var/opt/remi/php73/lib//var/opt/remi/php73/lib/php/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu












	






















directoryASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1aa9c134849409efc298c410fbb3eeb307528c00, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4dc2d02dec8981ca0fb4ffe0324a1e835dcc9a6d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically�x�������������0,�����X�
ar�	?1405pN�����=����!5ning�$1����������������
!5 5"5
�3a40a86d0407dac736e84ed4e46ee83b03b8bf4e4f40b989bf70b17704a4c1a124c9b7d6d1af29f4685a232103b06df5544f143662c8984e688834f781b121278c3bc5ea0c15ca403eb1aefcd96d072b522546da69009002f4991cff7a56058d12ae7a44c9562a47d734e7e2d6dfd440debfcecc575efbeae6ce35cc2d7726ed203fde10ed824e5509303c863a64f3c45b17a13325a8022f091dd701bfbc97b96a544950036f1e8b481f6b661ee44c881d03c60f7c1a82ec8d486730a2ca1c883e5449f732718af6442cc28d8b715f95074264f269cce650e74f8cd742905396225b4467deb07ee28a81f0a336c3c402cf4bd68a6a6aec2cff2cbd620c5d6288ecd8581e0c684bba3ba1a9b3b4c9e6ab09cf54367a50de0e81087ce9320391fce2c1998b67898e283b374aa70aa085fabfeae809193c7e488f4432ec6e2e6965c2ac1c8fff3db9a1ffde0bf26afd432f406f65de2cfddfc1ab9fee88460f204ae33126d82205f1f4c6a46a025301a3ebcf194c4b31af364616ba8b2b597b36c8bd95a9c5c487e922bd6ab7fb9dfe0694dca34a75a7587c6da873dd346158b900e3505b0d9612f93e92682466ce6288d4a25a21ca1451e9191c6733c17c90f84a7f74bc21d96d1310f67c2d9d169af775f5c11fbc8a303d82a41e4b09716563a874286bea08d62d83d12ee0b127721736432440ec97439ecc93167d881c2f0815d88d607eff47c552fab3f1f22be1e3f753d435b94b2c413b54a953fe3f16ce48d073346456dbb5f9bb51af3a5960fbe933caecf759cd71c474092c57fe6c8ca694af513d6ab506a8ea468ef7a7ba8a8afcf97cd477a3359b6fda8b94350792b540c0b59aedc24cffdc5998290e3bea127bcceb19b79d634a19f90d5db978e6bd52ced2d49ffae4d21fb849df3cf223dd44b30b70261742760561599028a99811b43f963e923d2173770e0537df05db1da447e5cd8b7d0d61f4ff4e6cf10f53ac9c0756e77e5b0b32c9a4773f062d939871c304bb9125cd6f785c488b187f9a025af9e1526d29f78aef8e71afa51f1afbdf97352756f8cf74bf2b0c895bb84a1a7a0dfa15d6f6980c23320fe904e1c98e7226ae838061d50621e892a3312e182e86f1d2e38babee35b0835a5e3bdb857d9523c83d91323d348837f8d1200201e75c15ee9c3cd66dea030d089d247b3ab2995271671dcf9c451c7327ec07e89ed759d95405bca82949cb4831d6a34c13bae04f5f7be6e6284029355a85772971b8c2497e2687765992ff3856848304ce51ef1ae7863ba83fbf48004997e83cacaf0f2dd37d9c2dfc0b1f16c8ff0338802e46f6dd38ca092152b244bcbd4c7afdd72f2bc72b19b9c9703c1f8ad57835cc1a2652149d7455abd0ed1a6bffd4061bc234eef54ae001c749bf4e59be435e6a82ce67162d05ae091e2a5e4eb0efea90a295f2cf458d1d47400f8d24d262a768011fd7e863e6ca5fa4ef5b716762513a02ed125ed55559c68d745bee030431c3e1b48932770222e75d91083a972764fcd672c2f3c9aa3cd854167388fc280a2835e14cef77285ede57261d79c50b30e26558dc1a656fbcefe3b6c7c09be002e78da7770f411786cb2d1b45caf9ae4c02b8e6cd6a46d8b1cec492229e0701b8a877a4af64f7f2d2fedd6de876db696144dd99311a698737657c060c738a2394f38aeb439d9e32665627d8e1a49cb6e5b73cfe441510b18c4c0c4433ba27f7de1b674a5ac2e7b3b8b9df7244be9e2d887e76d15ba82d643b877f13065c0a0617124ba395fb813efd3dbb3f7108c1829f9fbeb520835767d8340edf66c38f84c89e39cc3d279ac02dafd9aad49c4777e251ca220b7dd165a5b270bef16e3f7adf5104ff431153ffa2e96c4bc3eebb2848a3e37c476dcbcbd0375e43925b77885f89f589cd067f35a47a82d5f2897a9767ef05545964bca539e3dcf70f6d291bd46fc449b026e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855bb2f31519f8d0c4c3dd7ab6e8145e6f0783008688c3b47fe45c767a647d77cebae856614122d409d1392136e6bae61f0b74d9f2eeb99ea9511766ef744223f8a850bef5eeb8404ec8458ef0a0df2ec58a5635f9e5414c014c0ed1864c369cc0c523154115ad46b5842cdf1046a49a31c48d800bf49e400899b06721c5766cef1215218a1feac03f378644884d42d548734d7e3de5bac2367c82760aba098ab6f4ce39f422ee71467ccac8bed76beb05f8c321c7f0ceda9279ae2dfa3670106b318b2ec4c50f805de550e04d1ea653f171c8eb2bc5ce3ca8e368ad569179b783e1c46f4055244781244f4ffa6f5707187529c685f7a070a1eaa42422f9b1b55c4fb2ebcb1c0dcca8aaf4c9b892741937e37520a58c46256c262f824ee733835d37659b2c71172daeaa92d70ebf37f0388477b8e0bf6006b61b161c661c198b1a2ed7b6f4663b4751594a7c4959f6e0ebc8886163f3ee0e3f99ae4115225a02e1d4e1c83bea294e7295efc8bd8433fdbe93a7a523512d0f855a7ace0a9897d53a67d15af9f3d5a2336c8abd029de00240198031faa28e73c4cad4e99395072ab42eb647bd56e7d6d08ee37214ab0333b844d9a12410fb70341440d2d9ec12f8129b0a1e61daa12696eac2aeddd4f15152abd7eb2d56463b970e18f728d9537d33413c9563b69f07ba74982807e3761e1429ad82c32c1fd47528059eff8437ac0a17bf49a6ba236b6c34ba422f5b7df3def03767c66f45d0310944e1b536b7d576ccf5125b749cb02a5396340ce9fda7fffc4272d66af9443a947242291d�x�������������������X�
s@�?at.c��������0��������4enni�$k����������������
�4�4�4
�a bit more robust- added missing file mysql_create_system_tables to the server subpackage- removed dependency on MySQL-client from the MySQL-devel subpackage
  as it is not really required. (BUG 1610)- Fixed BUG 1162 (removed macro names from the changelog)
- Really fixed BUG 998 (disable the checking for installed but
  unpackaged files)- Fixed BUG 959 (libmysqld not being compiled properly)
- Fixed BUG 998 (RPM build errors): added missing files to the
  distribution (mysql_fix_extensions, mysql_tableinfo, mysqldumpslow,
  mysql_fix_privilege_tables.1), removed "-n" from install section.- removed the GIF Icon (file was not included in the sources anyway)
- removed unused variable shared_lib_version
- do not run automake before building the standard binary
  (should not be necessary)
- add server suffix '-standard' to standard binary (to be in line
  with the binary tarball distributions)
- Use more RPM macros (_exec_prefix, _sbindir, _libdir, _sysconfdir,
  _datadir, _includedir) throughout the spec file.
- allow overriding CC and CXX (required when building with other compilers)- re-enabled RAID again- disabled MyISAM RAID (--with-raid)- it throws an assertion which
  needs to be investigated first.- added missing file mysql_secure_installation to server subpackage
  (BUG 141)- re-added missing pre- and post(un)install scripts to server subpackage
- added config file /etc/my.cnf to the file list (just for completeness)
- make sure to create the datadir with 755 permissions- removed unusedql.com>

- Reworked the build steps a little bit: the Max binary is supposed
  to include OpenSSL, which cannot be linked statically, thus trying
  to statically link against a special glibc is futile anyway
- because of this, it is not required to make yet another build run
  just to compile the shared libs (saves a lot of time)
- updated package description of the Max subpackage
- clean up the BuildRoot directory afterwards- Updated Packager information
- Fixed the build options: the regular package is supposed to
  include InnoDB and linked statically, while the Max package
  should include BDB and SSL support- Use more RPM macros (e.g. infodir, mandir) to make the spec
  file more portable
- reorganized the installation of documentation files: let RPM
  take care of this
- reorganized the file list: actually install man pages along
  with the binaries of the respective subpackage
- do not include libmysqld.a in the devel subpackage as well, if we
  have a special "embedded" subpackage
- reworked the package descriptions- Added embedded server as a separate RPM- Added mysqld-max to the distribution- Added mysql-test to the bench package- Added separate libmysql_r directory; now both a threaded
  and non-threaded library is shipped.- Added the support-files/my-example.cnf to the docs directory.

- Removed devel dependency on base since it is about client
  development.- Cleaned up some for 3.23.- Added support for shared libraries in a separate sub
  package. Original fix by David Fox (dsfox@cogsci.ucsd.edu)

- The --enable-assembler switch is now automatically disables on
  platforms there assembler code is unavailable. This should allow
  building this RPM on non i386 systems.- Removed unportable cc switches from the spec file. The defaults can
  now be overridden with environment variables. This feature is used
  to compile the official RPM with optimal (but compiler version
  specific) switches.

- Removed the repetitive description parts for the sub rpms. Maybe add
  again if RPM gets a multiline macro capability.

- Added support for a pt_BR translation. Translation contributed by
  Jorge Godoy <jorge@bestway.com.br>.- A lot of changes in all the rpm and install scripts. This may even
  be a working RPM :-)- A developers changelog for MySQL is available in the source RPM. And
  there is a history of major user visible changed in the Reference
  Manual.  Only RPM specific changes will be documented here./bin/sh/bin/sh/bin/sh/bin/shmariadb-connector-c-configminimal-centos-6-x�x������������� �����X�
't�	?wn t�������������5, li�$	����������������
555
���������A聠��������������������A聠����A聠��������A聠��A聠��������������������A聠A聠����A聠��������A聠������������������������A聠����������A聠A聠��A聠����������������������A聠A�A�A聠A聠������������A�A聠������������������������������A聠��������������A聠������A聠��������������������������A�A聠������������������A聠����������A聠������������������������������������������������������������������������������������������������A聠A聠������A聠����������������������������������A聠������������������������������������������������������������A聠��������������������������������������A�A聠��������������������A聠��������������A聠A聠������A�A�A�A聠��������������A聠A�A聠����������������������������������������������������A�A聠������������������������A聠��A聠A聠��������������������������������A聠A聠��������A聠������A聠����A聠������A聠����������������������A聠����������������A聠������������������A聠��������A聠��������A聠��������������A�A聠������������������������������������A聠������������������������������������A聠A�A큠g29g2%g29g29g29g2�g2�g29g2�g29g29g2�g2%g2�g29g2�g29g2�g29g29g29g29g29g29g29g2�g29g29g29g29g29g29g2�g29g29g29g29g29g29g2�g2�g2�g2�g2�g2�g29g2�g29g29g29g29g2�g2�g29g2�g29g29g29g29g2�g2�g2�g28g28g2=g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g28g2�x��������������������X�
M �	?atch��������
����)5ts a�$9����������������
)5(5*5
�37d5b1b407b45979aff6f40762f422a65eafd08e04290a44021f73fada072546c4f63f8cf18a7181244ce4280b09cc15cc980b2d1176171ae74fd392c810884e2ea7e94aa3f57e9c1cbeb402319083d0c58e6a0e1282787c5156becc8aa6905482218abf3e04869b835226db4763645fff3438fdbd5f1cdd80f28d8fca4a09d87677882bde021820d9cf39a3b11a12405226211919cf13ce8a55a9e6fbe0a07146cef3990c8b45a068c3e83e369e1959ad9ca30306b4a09ad1d9b38ab3a20c6e17a38d519ee412ecaf6b918df18c78956ac7c330d4ea08dc22e58ff9c016f6c1ca1274b4802a926bcf78935060e1c813c5a0f021c6d143e6f4bf9561f9b89961f1503d558385fbae30d12bfed565de9bf76c33abb63620a660433788b652690c17710460da5d91e0c753d3318fd85f5e1e42862a71f259060a1b85826854d35863e31808f0668abfabdf33606e8f06bd8bb7761401e3edc0953408cd2570f0c83dc2fe39f7e4e388e41eeb05738aa69196a5f6ffcf6ba79e188236b1d0cf309c15afc7e6b4b71beab9b3d3416fe78384e6cde0a6229661ec5baf6a1c77bd343ff1d2c1d981393fa3ea8b5d2389073b8026ca87f38df48bd1run-with-local-pythonrun-with-local-pythonrun-with-local-pythonrun-with-local-python/usr/bin/python3.6pythonpythonrun-with-local-pythonrun-with-local-pythonrun-with-local-pythonrun-with-local-python�x�������������������X�
16�? bum���������I�������esto�$����������������
���
�only conflict with incompatible one- updated pam-redhat from elvis CVS
- removed obsolete patches- depend on db-4.3.27, not db-4.3.21.- add argument to pam_console_apply to restrict its work to specified files- update to Linux-PAM-0.78
- #140451 parse passwd entries correctly and test for failure
- #137802 allow using pam_console for authentication- rebuild against db-4.3.21.- #77646 log failures when renaming the files when changing password
- Log failure on missing /etc/security/opasswd when remember option is present- #87628 pam_timestamp remembers authorization after logout
- #116956 fixed memory leaks in pam_stack- #74062 modify the pwd-lock patch to remove NIS passwd changing deadlock- #134941 pam_console should check X11 socket only on login- Fix checking of group %group syntax in pam_limits
- Drop fencepost patch as it was already fixed 
  by upstream change from 0.75 to 0.77
- Fix brokenshadow patch- Added bluetooth, raw1394 and flash to console.perms
- pam_console manpage fix- #129328 pam_env shouldn't abort on missing /etc/environment
- #126985 pam_stack should always copy the conversation function 
- #127524 add /etc/security/opasswd to files- Drop last patch again, fixed now correctly elsewhere- Fixed bug in pam_env where wrong initializer was used- rebuild selinux patch using checkPasswdAccess- rebuilt- #75454 fixed locking when changing password
- #127054 
- #125653 removed unnecessary getgrouplist call
- #124979 added quiet option to pam_succeed_if- #126024 /dev/pmu console perms- Move pam_console.lock to /var/run/console/- Close fd[1] before pam_modutilread so that unix_verify will complete- First chunk of Steve Grubb's resource leak and other fixes- Fixed build testing of modules
- Fixed dependancies- Change unix_chkpwd to return pam error codes- Fixed the pam glib2 dependancy issue- Fixed the pam_limits fencepost error (#79989) since nobody seems to
  be doing it- rebuilt- Add requires libselinux > 1.8- Add MLS Support to selinux patch- Modify pam_selinux to use open and close param- Split pam module into two parts open and close- Fixed 64bit segfault in pam_succeed_if module.- Apply changes from audit.- Change to only report failure on relabel if debug- Fix error handling of pam_unix- rebuilt- fix tty handling- remove tty closing and opening from pam_selinux, it does not work.- rebuilt- pam_unix: also log successful password changes when using shadowed passwords- close and reopen terminal after changing context.- Check for valid tty- Check for multiple > 1- fix is_selinux_enabled call for pam_rootok- More fixes to pam_selinux,pam_rootok- turn on selinux- Fix rootok check.- fix is_selinux_enabled call- Check if ROOTOK for SELinux- Fix tty handling for pts in pam_selinux- Need to add qualifier context for sudo situation- Fix pam_selinux to use prevcon instead of pam_user so it will work for su.- add alsa devs to console.perms- rebuild with db-4.2.52.
- build db4 in build_unix, not dist.- Change unix_chkpwd to handle unix_passwd and unix_acct
- This eliminates the need for pam modules to have read/write access to /etc/shadow.- Cleanup unix_chkpwd- Fix tty handling 
- Add back multiple handling- Remove Multiple from man page of pam_selinux- don't install _pam_aconf.h -- apps don't use it, other PAM headers which
  are installed don't use it, and its contents may be different for arches
  on a multilib system
- check for linkage problems in modules at %install-time (kill #107093 dead)
- add buildprereq on flex (#101563)- make pam_pwdb.so link with libnsl again so that it loads (#107093)
- remove now-bogus buildprereq on db4-devel (we use a bundled copy for
  pam_userdb to avoid symbol collisions with other db libraries in apps)- Add Russell Coker patch to handle /dev/pty- Turn on Selinux- Fix pam_timestamp to work when 0 seconds have elapsed- Turn off selinux- Turn on Selinux and remove multiple choice of context.- Turn off selinux- Add Russell's patch to check password- handle ttys correctly in pam_selinux- Clean�x�������������x������X�
x_M?wd a�o�����������$mor n�$4����������������
$m#m
�E
"�?
�d
�
�
�
�	&
�	;
��
��
��
��
�

�

�	
)
�
?
�
S
�
Y

`<P<	�<
@<0<l<
�<�<�<�
<;�,}(�
8�9$�:�G
	�<H

�<I
|<X
�;Y
�;\

`<]
P<^
<b
n
d
�
e
�
f
�
l
�
t
�<u
�<v
��
�
�
S
�
\
�
`
�
|
�
�
�
�



�


�

�6


""


"K
�
"�


"�<
"�
g
"�
h
"�
Cphp74-php-common7.4.3310.el8.remiCommon files for PHPThe php74-php-common package contains files used by both
the php74-php package and the php74-php-cli package.exq�builder.remirepo.netl]�Remi's RPM repository <https://rpms.remirepo.net/> #StandWithUkrainePHP and BSDRemi ColletDevelopment/Languageshttp://www.php.net/linuxx86_64,60..6,40.48��r���@�
��
bXW�8
�@��^�
�@bh1�O6\�
��s�h�
=��
:�KHT�:��
j
��"
��dA큤������������������������A�A�������������A�A큤��������������A큤������������������A큤��������A�A�A�A�A�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�exq�c_�c_�c_�exq3c_�c_�c_�c_�c_�c_�c_�c_�c_�c_�c_�c_�c_�c_�c_�exq�c_�exq3exq3exq3exq3exq�exq�exq�exq�exq�e04c9d49bfbb7cb08ee926ff285d845d5b770013ea064edfbe258e20dd125d956ebb9a646920b93cbe5a18fa33892c01bfa1875daabba615553466739dabc93fa130289a1f4813f4025e96762bf9f11d80f87bcc0fd6c56de95fd126296eb8a86cc545d1c734f8c91e99423410657f7126595a2e835218c2466d9f4fa7ac7c5c7acb4b16de295c639e0900760f5755a87cad7eae677f7e3858aecfe185092bc3e37b5fa8a34cfb783b45dfc1f2316524a075e237ca09e5368664d2e795aad9620ff188cda5cc2c112733acb8d3bc4cc60d40490d823da846e6f5a8bbc49b670fea895d1c6138a599088f55a0c12c424bf52e8f9a26622206143db2261d5055da40993186bab843ec33a6e789b3cc5f6395f7e9efd18069b5d8dac2629c6754589d5f6d2aed5c6894288d806eaf848a0a6f450595cf1f20140589a10e82e987010e5be9bff7b2b44ba2f005325e46ac02a45820e399a778f88d165da1ff9216557a42b5a7f4888df88f2c70f34b157eedcf62c75275781ed0af2ce37fad9515d8d6433207545d281f97f93acfa5fcd81ba566fddc50e28c673b47f4c346b1c4801c768cf705058f8e6608509d04566827b70e046c432cde5467037558a1d49739df9153e2ca0271e03397bde72eb8e377a9b566a69479c298101c357d25a80d734287f4c67d9d49489544f3d0453e048a7f7ab618404a82d96f48e83e9fdd20b453bf3e6635c0408f832e908dd6a41cbc16011b6848d0f6a3a4d386401c57be7f3c26ebaf456f1ab678081153f2e2021f4ad502940d3776080371dde9a6188c13322518888d2e473693dc8c9bf43d8c43ee37524511ea31e119fdc27e9ef7e08c92d540b101c2733a9949519523fa5269d6a2fe22ef4a77e44e627b91df92dcefe2ae0d67e7266e7244ed433c5c8e35739e8d8e69abce5c6d155d7d439982c64ab914d8bb7de1c7cb56605d95401c17a144b73247b656d904f633463b2c27a24d42111a5e0e5c37a7c3facd87fe623fd17fced871000f40fac35583e486f1487cc53accef706cf40a60329d351f457b1d135c22b33a0a8f838ede241965cade994efa63d5fa73df5c6098e099ae6990e11d258ad25c6bd88d947135132a62ebe39e86884d780916ec8e0868ef47ab851294d60049a1823a70bc2248bc999f69aded420b8f5652ccca2202dfd4bbf0cb1324deae8e847971488ec42a4d04bbfc7edccc3f3cee2d0de52367b5c652e2b7135099689b29c0a70c7bcab7c39b48e2ae92938930310885214e6d130133d6612900e4658fc41c8c11842a812dca2e2�x��������������������X�
47�?reve���������
�����hon_�$F����������������
���
�nts
  - adjust paths in init scripts
  - drop upstreamed fix for KDC denial of service (CVE-2010-0283)
  - drop patch to check the user's password correctly using crypt(), which
    isn't a code path we hit when we're using PAM- fix a null pointer dereference and crash introduced in our PAM patch that
  would happen if ftpd was given the name of a user who wasn't known to the
  local system, limited to being triggerable by gssapi-authenticated clients by
  the default xinetd config (Olivier Fourdan, #569472)- fix a regression (not labeling a kdb database lock file correctly, #569902)- move the package changelog to the end to match the usual style (jdennis)
- scrub out references to $RPM_SOURCE_DIR (jdennis)
- include a symlink to the readme with the name LICENSE so that people can
  find it more easily (jdennis)- pull up the change to make kpasswd's behavior better match the docs
  when there's no ccache (#563431)- apply patch from upstream to fix KDC denial of service (CVE-2010-0283,- update to 1.7.1
  - don't trip AD lockout on wrong password (#542687, #554351)
  - incorporates fixes for CVE-2009-4212 and CVE-2009-3295
  - fixes gss_krb5_copy_ccache() when SPNEGO is used
- move sim_client/sim_server, gss-client/gss-server, uuclient/uuserver to
  the devel subpackage, better lining up with the expected krb5/krb5-appl
  split in 1.8
- drop kvno,kadmin,k5srvutil,ktutil from -workstation-servers, as it already
  depends on -workstation which also includes them- tighten up default permissions on kdc.conf and kadm5.acl (#558343)- use portreserve correctly -- portrelease takes the basename of the file
  whose entries should be released, so we need three files, not one- suppress warnings of impending password expiration if expiration is more than
  seven days away when the KDC reports it via the last-req field, just as we
  already do when it reports expiration via the key-expiration field (#556495)
- link with libtinfo rather than libncurses, when we can, in future RHEL- krb5_get_init_creds_password: check opte->flags instead of options->flags
  when checking whether or not we get to use the prompter callback (#555875)- use portreserve to make sure the KDC can always bind to the kerberos-iv
  port, kpropd can always bind to the krb5_prop port, and that kadmind can
  always bind to the kerberos-adm port (#555279)
- correct inadvertent use of macros in the changelog (rpmlint)- add upstream patch for integer underflow during AES and RC4 decryption
  (CVE-2009-4212), via Tom Yu (#545015)- put the conditional back for the -devel subpackage
- back down to the earlier version of the patch for #551764; the backported
  alternate version was incomplete- use %global instead of %define
- pull up proposed patch for creating previously-not-there lock files for
  kdb databases when 'kdb5_util' is called to 'load' (#551764)- fix conditional for future RHEL- add upstream patch for KDC crash during referral processing (CVE-2009-3295),
  via Tom Yu (#545002)- refresh patch for #542868 from trunk- move man pages that live in the -libs subpackage into the regular
  %{_mandir} tree where they'll still be found if that package is the
  only one installed (#529319)- and put it back in- back that last change out- try to make gss_krb5_copy_ccache() work correctly for spnego (#542868)- make krb5-config suppress CFLAGS output when called with --libs (#544391)- ksu: move account management checks to before we drop privileges, like
  su does (#540769)
- selinux: set the user part of file creation contexts to match the current
  context instead of what we looked up
- configure with --enable-dns-for-realm instead of --enable-dns, which isn't
  recognized any more- move /etc/pam.d/ksu from krb5-workstation-servers to krb5-workstation,
  where it's actually needed (#538703)- add some conditional logic to simplify building on older Fedora releases- don't forget the README- specify the location of the subsystem lock when using the status() function
  in the kadmind and kpropd init scripts, so that we get the�x�������������h������X�
e �? sho�������(������h 146�$w����������������
�h�h�h
�easy_install.cpython-36.opt-1.pyceasy_install.cpython-36.pyceasy_install.pypkg_resources__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycpy31compat.cpython-36.opt-1.pycpy31compat.cpython-36.pyc_vendor__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycappdirs.cpython-36.opt-1.pycappdirs.cpython-36.pycpyparsing.cpython-36.opt-1.pycpyparsing.cpython-36.pycsix.cpython-36.opt-1.pycsix.cpython-36.pycappdirs.pypackaging__about__.py__init__.py__pycache____about__.cpython-36.opt-1.pyc__about__.cpython-36.pyc__init__.cpython-36.opt-1.pyc__init__.cpython-36.pyc_compat.cpython-36.opt-1.pyc_compat.cpython-36.pyc_structures.cpython-36.opt-1.pyc_structures.cpython-36.pycmarkers.cpython-36.opt-1.pycmarkers.cpython-36.pycrequirements.cpython-36.opt-1.pycrequirements.cpython-36.pycspecifiers.cpython-36.opt-1.pycspecifiers.cpython-36.pycutils.cpython-36.opt-1.pycutils.cpython-36.pycversion.cpython-36.opt-1.pycversion.cpython-36.pyc_compat.py_structures.pymarkers.pyrequirements.pyspecifiers.pyutils.pyversion.pypyparsing.pysix.pyextern__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycpy31compat.pysetuptoolssetuptools-39.2.0.dist-infoDESCRIPTION.rstINSTALLERLICENSE.txtMETADATARECORDWHEELdependency_links.txtentry_points.txtmetadata.jsontop_level.txtzip-safe__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycarchive_util.cpython-36.opt-1.pycarchive_util.cpython-36.pycbuild_meta.cpython-36.opt-1.pycbuild_meta.cpython-36.pycconfig.cpython-36.opt-1.pycconfig.cpython-36.pycdep_util.cpython-36.opt-1.pycdep_util.cpython-36.pycdepends.cpython-36.opt-1.pycdepends.cpython-36.pycdist.cpython-36.opt-1.pycdist.cpython-36.pycextension.cpython-36.opt-1.pycextension.cpython-36.pycglibc.cpython-36.opt-1.pycglibc.cpython-36.pycglob.cpython-36.opt-1.pycglob.cpython-36.pyclaunch.cpython-36.opt-1.pyclaunch.cpython-36.pyclib2to3_ex.cpython-36.opt-1.pyclib2to3_ex.cpython-36.pycmonkey.cpython-36.opt-1.pycmonkey.cpython-36.pycmsvc.cpython-36.opt-1.pycmsvc.cpython-36.pycnamespaces.cpython-36.opt-1.pycnamespaces.cpython-36.pycpackage_index.cpython-36.opt-1.pycpackage_index.cpython-36.pycpep425tags.cpython-36.opt-1.pycpep425tags.cpython-36.pycpy27compat.cpython-36.opt-1.pycpy27compat.cpython-36.pycpy31compat.cpython-36.opt-1.pycpy31compat.cpython-36.pycpy33compat.cpython-36.opt-1.pycpy33compat.cpython-36.pycpy36compat.cpython-36.opt-1.pycpy36compat.cpython-36.pycsandbox.cpython-36.opt-1.pycsandbox.cpython-36.pycsite-patch.cpython-36.opt-1.pycsite-patch.cpython-36.pycssl_support.cpython-36.opt-1.pycssl_support.cpython-36.pycunicode_utils.cpython-36.opt-1.pycunicode_utils.cpython-36.pycversion.cpython-36.opt-1.pycversion.cpython-36.pycwheel.cpython-36.opt-1.pycwheel.cpython-36.pycwindows_support.cpython-36.opt-1.pycwindows_support.cpython-36.pyc_vendor__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycpyparsing.cpython-36.opt-1.pycpyparsing.cpython-36.pycsix.cpython-36.opt-1.pycsix.cpython-36.pycpackaging__about__.py__init__.py__pycache____about__.cpython-36.opt-1.pyc__about__.cpython-36.pyc__init__.cpython-36.opt-1.pyc__init__.cpython-36.pyc_compat.cpython-36.opt-1.pyc_compat.cpython-36.pyc_structures.cpython-36.opt-1.pyc_structures.cpython-36.pycmarkers.cpython-36.opt-1.pycmarkers.cpython-36.pycrequirements.cpython-36.opt-1.pycrequirements.cpython-36.pycspecifiers.cpython-36.opt-1.pycspecifiers.cpython-36.pycutils.cpython-36.opt-1.pycutils.cpython-36.pycversion.cpy�x�������������������X�
Gd{?reen���������������JN5744�$Z����������������
JNKNIN
� icon is the list view
- change the schema for the xml data; the database now has a version,
   there is a local id attached to each signature, the filter list in
   the siginfo was replaced by a list of per user data, the per user
   data now contains the filter, seen_flag. Modify all the code which
   was operating on the filter information to use the new model.
- fix the xml serialization so that booleans can be used as a basic
   type and also so that non-string types can be used in element
   attributes (e.g. int, bool) and the serialization code will
   automatically convert between python types and strings.- Add dispatcher.py[John Dennis <jdennis@redhat.com>]
- clean up and rework the timestamp code in util.py so that
   time zones are handled properly, there were a number of bugs.
   Hopefully it's correct now because timezone handling is a pain.
- change the time format in the browser so all times are displayed
   identically, the friendly time relative format was hard to compare.
- modify the plugin 'make install' to delete all existing plugin's
   prior to installing the new ones
- add popup menu to status icon to choose between browser and
   alert GUI (not fully connected yet). Several bug fixes related
   to changing the filter_type from a string to an int.
- add filter selection to bottom pane, change filter_type from
   string to integer constant. Enhance how columns are handled.
   Get init_combo_box to work. Remove unused RPM and Bugzilla
   fields from bottom pane. Modify the default size of the browser
   window. Fix missing import in util.py.
- add ability in broswer to sort on columns, initially the report
   count column and the last seen date column. The date column now
   stores a TimeStamp object instead of a string. Add new method
   to TimeStamp to return a friendly string relative to the current
   time. The date column in the browser now has a cell data function
   which invokes the friendly format method of the TimeStamp object.
- add ability fo serialize to/from xml for classes which can
   inititialized from strings and serialized as strings (e.g. numbers,
   TimeStamps, etc.)
- add count of how many times a signature is reported, the date
   when first and last reported, add columns for report count and
   last date count to browser.
- checkpoint browser code, list pane and detail pane now working.
- add initial support for browser applet, move some functions which
   kept getting reused to util.py
- add reporting of environment to email alert (email alerts still
   need work)
    [Dan  Walsh <dwalsh@redhat.com>]
- Fix disable_trans.py set_boolean call
- Complete all boolean plugins except disable
- Change interface to use audit unix domain socket[John Dennis <jdennis@redhat.com>]
- modify SetFilter in server to return errors instead of
   throwing an exception. Default the filter list on each alert display.
- minor tweaks to alert queue handling
- fix analyze() parameter list in ftp_is_daemon.py plugin
- sealert now responds to pending alerts more correctly, it shows
   how many pending alerts are in the queue, if you filter the pending
   alert status is updated, the next alert button will advance you
   to the next alert in the queue
- simplify major pieces of sealert by coalescing common code
   into subroutines.
    [Dan  Walsh <dwalsh@redhat.com>]
- Complete all boolean plugins except disable
- Make Close button work.
- Make setroubleshoot_dispatcher exit if it gets an avc about itself[Karl MacMillan <kmacmill@redhat.com>]
- Add generic templating mechanism to Plugin
- Ported all plugins to use templating mechanism- Fixes to plugins
- Fixes to dispatcher- Fix problem in dispatcher- add email alerts
- stop the status icon from blinking, add notification balloon.- Fix startup order for setrobleshoot
- Fix Plugins- Additional Plugins plus a lot of cleanup- Added a bunch more plugins
    [Karl MacMillan <kmacmill@redhat.com>]
- Add allow_cvs_read_shadow.py, allow_ftp_use_cifs, allow_ftp_use_nfs, and allow_gssd_read_tmp.
- Change AVC to have additiona�x�������������X������X�
 a�?reat@������������-�t (#�$=����������������
-�.�,�
�����������A큤A큤����������������������������������������������������������������������������������������������������������A큤��������������������������������������������������������������������������������������������A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A�A�A�iC	PiC	PiC	PiC	PiC	PiC	PiC	PiC	PiC	PiC	PiC	EiC	FiC	FiC	FiC	FiC	FiC	GiC	HiC	IiC	IiC	JiC	JiC	JiC	PiC	GiC	KiC	LiC	MiC	PiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	TiC	PiC	PiC	EiC	PiC	EiC	QiC	EiC	QiC	PiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	PiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	PiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	PiC	PiC	PiC	PiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	QiC	TiC	8iC	EiC	=iC	=iC	<iC	<iC	<iC	<iC	=iC	<iC	=iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	<iC	=iC	=iC	=iC	=iC	=iC	=iC	=iC	=iC	<iC	<iC	<iC	=iC	<iC	EiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	DiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	EiC	TX���iC�iC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	OiC	EiC	PiC	FiC	FiC	FiC	GiC	GiC	QiC	HiC	IiC	JiC	OiC	OiC	GiC	QiC	PiC	KiC	LiC	QiC	PiC	MiC	OiC	GiC	JiC	OiC	EiC	FiC	FiC	EiC	EiC	FiC	FiC	GiC	GiC	GiC	GiC	HiC	HiC	HiC	HiC	HiC	IiC	IiC	IiC	IiC	IiC	JiC	JiC	JiC	JiC	JiC	KiC	FiC	KiC	KiC	KiC	KiC	LiC	LiC	LiC	LiC	MiC	MiC	MiC	MiC	MiC	NiC	NiC	NiC	NiC	NiC	OiC	KiC	NiC	NiC	FiC	PiC	L4f10f27a970924ba9f636f2d5fdb4267c3ada93f7b4eee1bc3ad05c33406e76cef504b9d80c9db13ebd0d4aca651de31784938caa4e059d13964e48032057219c5c2a7c1f8dfbefa5df66cd32a7b754266d6375471d43cea06b8bea937d24b40515f0848df9db305c4c1505220bd4292f1036245dced25a62baffd1321eb28043b565d5426d2dbb52dd605d009c151b0b35c4411d37241049b26cb60f4b36add92324438a5920c58e8f1be4c39256cd44a53f46eee4587f42bfc48011e8b19a5515f0848df9db305c4c1505220bd4292f1036245dced25a62baffd1321eb2804f68915c4eb637aacbfa01cf26dc469a73f70acb0495efc4b074ecbc626bcb3�x������������������X�?��������P������4�$h����������������
�4�4�4
�viates from the default file locations
  ("datadir" and "pid-file"), the mechanism to detect a running server (on upgrade)
  should still work, and use these locations.
  The problem was that the fix for bug#27072 did not check for local settings.- Install the new "manifest" files: "INFO_SRC" and "INFO_BIN".- EXCEPTIONS-CLIENT has been deleted, remove it from here too
- Support MYSQL_BUILD_MAKE_JFLAG environment variable for passing
  a '-j' argument to make.- Added test authentication (WL#1054) plugin binaries- Added example external authentication (WL#1054) plugin binaries- With a recent spec file cleanup, names have changed: A "-community" part was dropped.
  Reflect that in the "Obsoletes" specifications.
- Add a "triggerpostun" to handle the uninstall of the "-community" server RPM.
- This fixes bug#55015 "MySQL server is not restarted properly after RPM upgrade".- Change the behaviour on installation and upgrade:
  On installation, do not autostart the server.
  *Iff* the server was stopped before the upgrade is started, this is taken as a
  sign the administrator is handling that manually, and so the new server will
  not be started automatically at the end of the upgrade.
  The start/stop scripts will still be installed, so the server will be started
  on the next machine boot.
  This is the 5.5 version of fixing bug#27072 (RPM autostarting the server).- Implement SELinux checks from distribution-specific spec file.- Large number of changes to build using CMake
- Introduce distribution-specific RPMs
- Drop debuginfo, build all binaries with debug/symbols
- Remove __os_install_post, use native macro
- Remove _unpackaged_files_terminate_build, make it an error to have
  unpackaged files
- Remove cluster RPMs- Add "--with-perfschema" to the configure options.- User "usr/lib*" to allow for both "usr/lib" and "usr/lib64",
  mask "rmdir" return code 1.
- Remove "ha_example.*" files from the list, they aren't built.- Fix a wrong path name in handling the debug plugins.- Take the result of the debug plugin build and put it into the optimized tree,
  so that it becomes part of the final installation;
  include the files in the packlist. Part of the fixes for bug#49022.- Set "Oracle and/or its affiliates" as the vendor and copyright owner,
  accept upgrading from packages showing MySQL or Sun as vendor.- Formatting changes:
  Have a consistent structure of separator lines and of indentation
  (8 leading blanks => tab).
- Introduce the variable "src_dir".
- Give the environment variables "MYSQL_BUILD_CC(CXX)" precedence
  over "CC" ("CXX").
- Drop the old "with_static" argument analysis, this is not supported
  in 5.1 since ages.
- Introduce variables to control the handlers individually, as well
  as other options.
- Use the new "--with-plugin" notation for the table handlers.
- Drop handling "/etc/rc.d/init.d/mysql", the switch to "/etc/init.d/mysql"
  was done back in 2002 already.
- Make "--with-zlib-dir=bundled" the default, add an option to disable it.
- Add missing manual pages to the file list.
- Improve the runtime check for "libgcc.a", protect it against being tried
  with the Intel compiler "icc".- Change RPM file naming:
  - Suffix like "-m2", "-rc" becomes part of version as "_m2", "_rc".
  - Release counts from 1, not 0.- The "semisync" plugin file name has lost its introductory "lib",
  adapt the file lists for the subpackages.
  This is a part missing from the fix for bug#48351.
- Remove the "fix_privilege_tables" manual, it does not exist in 5.5
  (and likely, the whole script will go, too).- remove erroneous traces of the InnoDB plugin (that is 5.1 only).- Removed mysql_fix_privilege_tables- "mysqlmanager" got removed from version 5.4, all references deleted.- Merge up from 5.1 to 5.4: Remove handling for the InnoDB plugin.- This version does not contain the "Instance manager", "mysqlmanager":
  Remove it from the spec file so that packaging succeeds.- Add conditionals for bundled zlib and innodb plugin- Install plugin libraries in appropriate packages.
- Di�x�������������Hv�����X�
�	?���������H�����5�$����������������
55 5
�8670838fcaf7bc0d379b0426dbbedb6f9e6a7944d9e37e105fccf306c9d4bcbffcc26e004154d9d9992a10440bfe5370f5ff68c0229b075bf5ab357492996853541f63a158854155de9990927f58ae6c358f1c5924caa560d58c370c8380309d9b765c9081415086e1c05bc7541ac913a0d592746e5e580dbd32036ab9ddbe594d0a4e56641229742c50d2471df4402ec5487ce883f09769d084918e08e254dedfd1ef3119e409e46336a1e675740f276d2794cfbb19d9af8167b3e3e78ee12b97a5aeed0620e2e6f45743c5af74503355a49fa32a14c4d05f15b81dbcc8a59f652831c1dc637c48fe328877a74e67fc83f3f16368d56c9db853a00795484d403b3cbc82e6825137347231b07168a235975e8c0d77a7a10fe3245ac6a9cfe221edc47389e91db3c47ab5fe6f214d18f3559f797257f25b3078a2e69c2c2693c507110b0b824affacffe411bbe2bc2e2a3ceae57806bc85a2f568438c4fb14171ef348cab9cbbc46cc01883251267ae4751fca5c737499f8aee1bf2cc663a251019c4983027fb144bd93459892f318d34601605abe9989bf606ed09f209cc5513c730579f4d1be8fe16b59abc8b8a0f0207080e83d894da915104fc2ccddc4f91661c63f48a2b1c1654d6103f763002ef06e9e0aae4f42269bb13b46ce6dba0972fea03605aea2c61999df2a10476ce72ec34bf64beb8d4358a10bbe72841bd2bb1db880b159bf743272d3300ba3b12c9757f9bc0f33cfe933c61bff8f57bb6ab29bbf77c76eb9eaa6eee37ee5e434687530d46846d247ec365db26687ab22b8e8a9269e4e70407889c093cf252aaa225a5e65174c7a893a14b189341c1dba03352739ca87dcda4a175d01471728edcae9ed51f3475c171e750cb5e8e9c342671ff24ef177586ac304eb08d5aa9d733fb4ca2e08adfc1a9d3a6d4f04b2704e3e3fe41ab0f9b377e5d56207afcadce3944cc106ef4b6228391845937f451053a54855ad815c9b4623fa87b0652e574755c94d914f011f797851fdbeea927ef2d064df8be628de6b6e4d3810a85eac3cb393bdc4b487a4d19e762ad8ec46d56743e493b2c5c755a67edd1b4abebc1f275abe666e1e498df6c15205dc7cdc8d8dc1684b29cbd99eb5b3522b120807444a3e7eed8e92e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e35b4bab778b4ab0446c455542954616af4aee8d659fd6f51e9635974842510a9e6c8ccaec731bcec337a2b7464d8c53324b30b47af4cad6a5d9c7ccec15530486a79f42e5e6885c83040ace8ee8c7ea177a5855e5383d64582b310e18f1e557208b7e9598f4589a8ae2b9946732993f8189944f0a504b45615b98f7a7a4e4c40e96535c25f49d41d7c6443db2be06671181fe1bde67a856b77b8cf7872058ab21d0fcbf7cd63ac07c38b8b23e2fb2fdfab08a9445c55f4d73578a04b4ae204c0380882c501df0c4551b51e85cfa78e622bd44b956c95ef76b512dc04f13be7fa42744aebcb32d2cc35b93fead13c194f2ea6c1b4844d241e9c320a1e267b3994e8a7811e12e69074159db5e28c11c18e4de29e175f50f96a3febf0a3e643b34c95ec212609bd7d3239c928e0d9104bcc1ff7e76c98709e9ce8e2cc59b865e603e9ae8bc3371313aefa0d1c570bd8d663a47d97cc373c04bc4bc6212b7d497896c9f0897d8f0681379049f1b98de85a18675418b8c2afda3f1f1ab5e1ed3263cdb2ff66fb66cbf7e1f780b0febb98b39573e060ab9d667581a8e7bd55a6b96b31d318b3fb7674d14d009b11934653106afb4b286ebd0a414327df277ab8439b06ea4bf753387eae5bd88681dd2ecdfa4f8e8eaf678c693d9ee4c9f649daf35ac29679c20d75b14d3b148e3f57c617af340899da0ba4b87c146012d6984f0d228217fc6d8d3eac1e70989b9080e37b4e1baaed31a4791f490d8668674456a3396b3064ac6af516397bdaf73d70ab96f40f32cbce7625990531cb11ba92f0b24b50501c595bea9b9b0a5fddbd3d4d8edcc8b61ca5a1f8ca8aca31db7f6cb438345221a7bad745c8db20ac3c08e9bdc1278f57d0111976d217d8065c0327d90f8a57dbb317393df276c01c752b893a990da0a0062cf86656d2d70e3c8944fef7f422a5d18bcf40a73839ca558bb939705ce2c9d335c4e2bc8aa7712c65e06d91d5e51f72298d5b5f4007b20a59a9b855a25b5ee081bc0aca7d2c61575e84c1abf3100a941de866f7ce4e0e04d02b5fc0ecee8c52f5f57e55e17500e1e1dd28ebb8e9d0121626828ade681673c85cf062c5f124046eddfa38124ba7535eb7535ea21f5cef421210ac018e650e1ee21d3b28159d154448e29d358a7d6b64d59f8aab2bdab68c4576606bea27beb1355754d3ce3c6deec0c0d62539c41029e6ef10c2c2f06cf92c73403524c6e2e979ee3dd301527f375fb04fb85356a8f184288ebdfb634b010d20d795f7544e67179ce734d23118368c478a7387a7c821c3ccdbc41352df104254095ddf925514d99bfb5411c95b5386e90caf06557979f82e16844f1618387a688f162408e7811350a72269076d52bf6d0f09860548d5b57d677aca00a877acefcad45953343ad56a22152f7aaba5fcf2a10215d84169d47fbcd1dd14abfa9aeb71422ed77235d5af32798f6e24af55afb290733613c1d3ecb4885586fff2f201ad86c2603aa92a0426dbc913c4440352d9a5b4a2cf2f16be124b9949b6765d794c53656c9afc45b90d9a2cfcae6bb30444086b29225f19242217b43f1ddcd5bbdcf161d6816b79b4889e7f75d2ce12ab4f7bcc77d16003a17c�x��������������e�����X�
tt�?www.8�����Xm�����U_7.p�$����������������
�U�U�U
�/licenses//usr/share/licenses/gnupg2//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en@boldquot/LC_MESSAGES//usr/share/locale/en@quot/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1//usr/share/man/man7//usr/share/man/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu
	





















			

































directoryemptyELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d2c0e5224e1d84ae06dcbeb95eaf633d26a4d0d3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=116b84f65130040a8812080fefc4362cd299233f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ca594e8bffaaebb02f3564513643fa445c4c1786, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f0c6869b72555fe9d01cedb60916b5d411fe22e6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=51c04d6bdb70b112e2d953b4591bb8c19365b9de, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=adc9de06b2fa4cd4ef6�x�������������(U�����X�
ako? opt�����(������aEer-i�$q����������������
aEbE`E
�ealert: exit on any connection close (#1875290)- Optimize get_rpm_nvr_by_type by adding a cache (#1794807)
- Stop building seappletlegacy (#1878792)
- Update translations- Add 'fur' into shipped locales
- Update translations (#1820570)
- Log full reports with correct syslog identifier
- Cancel pending alarm during AVC analyses- browser: Check return value of Gdk.Screen().get_default() (#1574434)
- Improve and unify error messages (#1763982)
- setroubleshoot.util: Catch exceptions from sepolicy import
- Add dpkg support
- Do not refer to hardcoded selinux-policy rpm in signature
- Make date/time format locale specific (#1812674)
- Improve speed of plugin evaluation (#1794807)
- Do not try to report a bug on None package
- sealert: Drop unused import slib.dbus.service
- Drop updater.py - it's not used and doesn't work
- root user doesn't need to use SetroubleshootPrivileged API
- Use pydbus, a modern Python dbus API, for SetroubleshootPrivileged
- Report bug on a package which owns the related SELinux domain (#1811644)
  https://pagure.io/setroubleshoot/issue/18
- Add Local SELinux policy package version to analyses reports
- setroubleshoot.utils.get_rpm_nvr_by_scontext add option to use DBUS method
- Export setroubleshoot.utils.get_rpm_nvr_by_scontext via DBUS
- setroubleshoot.util: get_rpm_nvr_by_type() and get_rpm_nvr_by_scontext()- Log plugin exception traceback when log level is DEBUG
- sepolicy.info() returns a generator, not a list (#1784564)- sepolicy.info() returns a generator, not a list (#1784564)- Use dbus.mainloop.glib.DBusGMainLoop() instead of dbus.glib
- Fix AVC.__typeMatch to handle aliases properly
- Handle sockets with abstract path properly (#1775135)- Fix file mode of email_alert_recipients (#1741960)- Add man page for seapplet (#1612529)- Update "missing" scripts to automake-1.15
- Add active polling for acquiring policy file
- Fix translation of hex values in AVCs (#1477236, #1709742)
- require initscripts to ensure that "service" call works properly- Require plugins >= 3.3.10- Update translations
- Catch exceptions caused by lookup_signature- Update scriptlets to reload auditd after install or uninstall- Update translations
- Improve myplatform detection in get_os_environment()- Move sedispatch.conf to /etc/audit/plugins.d/
- Fix summary and "if" text for AVCs with unknown target path- Switch hardcoded python3 shebangs into the %{__python3} macro- Set auto_save_interval to 5 (#1548913,#1523406,#1539180)
- seapplet: Try send and close notifications (#1541624,#1541719,#1544222,#1539367)- Do not show status_icon when there's no alert (#1543758)
- Run seapplet only on SELinux enabled system (#1541631)
- Use context in Gio.AppInfo.launch (#1542156)- Escape macros in %changelog- Fix runtime dependency: 's!lipreport!libreport!g' (#1536580)
- Prefer %global over %define
- Remove obsolete %defattr(-,root,root,-)- Rewrite seapplet to Python3 to use Notify and Gtk 3.0
- Add setroubleshoot-seappletlegacy with legacy seappletlegacy based on Gtk 2
- sealert: Finish dbus communication after error- Remove obsolete scriptlets- Update translations- Update translations- Increase the space for suggested solutions in sealert
- Highlight suggestions with the highest confidence
- Remove additional "If " string from plugin messages
- Fix sealert message for process2 (#1507909)
- Do not change if_string[0] to lowercase- Don't stop when the plugin directory is empty
- Fix missing margins on Troubleshoot window
- Resize all solutions panels horizontally
- Fix missing priority color for proposed solutions
- Do not split If sentences to framework and plugins - requires
  setroubleshoot-plugins 3.3.8 at least (rhbz#1210243, rhbz#1322734, rhbz#1115510)
- Set translation domain for Gtk.Builder() object to have strings
  correctly translated
- Make labels on GtkButtons translatable
- Handla all exceptions from do_analyze_logfile()
- Fix semi-translated messages
- Update translations
- Do not catch POSIX signals (rhbz#1366004, rhbz#1419245)- Rebuilt for https://fedoraproject.org/wi�x��������������D�����X�
cf�?a885��������`H������52e0a�$����������������
55
�R6R5RARFR4R@R-R(RRWRRRR4R@R-R(RRWR5RFRRRRR4R@R-R(RRWR)R5RRRRKRJRGRARFR4R@R-R(RRWR)R5RRRRARLRKRFR4R@R-R(RRWR"R,R)R1R0R9R:RR.RPR7R6R5RGRLRKRHRARFRJRRR?R=R$RRRRRRRRRRRR'R4RR/R!R<R#R&ROR8R@R-R(RR
RWR"RRPR,R+R*R)R1R0R9R:R.R?R>R=RRR'RDRHRJRARKRFR$RRRRRRRR7R6R5R4RR/R!R<R#R&ROR8R@R-R(RR
RWif [ -d /usr/share/mysql ] && [ ! -L /usr/share/mysql ]; then
  MYCNF_PACKAGE=$(rpm -qf /usr/share/mysql --queryformat "Percona-Server-57")
fi

if [ "$MYCNF_PACKAGE" == "mariadb-libs" -o "$MYCNF_PACKAGE" == "mysql-libs" ]; then
  MODIFIED=$(rpm -Va "$MYCNF_PACKAGE" | grep '/usr/share/mysql' | awk '{print $1}' | grep -c 5)
  if [ "$MODIFIED" == 1 ]; then
    cp -r /usr/share/mysql /usr/share/mysql.old
  fi
fiif [ -d /usr/share/mysql ] && [ ! -L /usr/share/mysql ]; then
  MYCNF_PACKAGE=$(rpm -qf /usr/share/mysql --queryformat "Percona-Server-57")
  if [ "$MYCNF_PACKAGE" == "file /usr/share/mysql is not owned by any package" ]; then
    mv /usr/share/mysql /usr/share/mysql.old
  fi
fi

if [ ! -d /usr/share/mysql ] && [ ! -L /usr/share/mysql ]; then
    ln -s /usr/share/percona-server /usr/share/mysql
fi/bin/sh/bin/shutf-8bbd9028fce9619ff9d4c2531db4eef628cc980f1b91e001e3b7d4ae092c52dcb?��� 
�`�
_���
	�4�_�兩�����2
�p����^E�q�pQ"��?e�7�=���썸��9�;�	��
�
�kN ��<�'��+���?��M��F��a�qB ��g�Q}�u0��=�0��N]�nH����	>*)1��w���^��چ�\��@^�ݞ���Ad�rR7��MC]���S��]y��/e���+�c�~�Pr��uK4��ΏFP���:V��a���^��X�3�e���)�ԇ$s7W�D����f���G��P>a����}A�#�nk1�\i�H���
�����?��Uw�b-��k�^��n�j�X��(/�N��:cޒ�@�j��q5����6�D�
·p�zB�#�^�
��S���Wjkj������WV�%�lU��d�����5�Դ4�'����l���쨟A2֢*`�_���T���c���+%FHXK���}\��+�Uw��)��YbY�_Q22�$�p���…�V��b\��_�LD#�1�ȶ�<�V��9����X��h�#w���\i�
_���
	�4�_�讀�ӟe=��-�[��6����1�^j��ё�9J������3�j��uJ؛�`yM�\�_A�Q���Do
�/	c�!�i��p_K�0�Y�C��IK����챥�(~*�d��խ>��K0y�{Vs�U'�k[o˃�1��o�
��g�j��1Ƌ���P�o�H��^�!�̪�mؽH�bT*�*F=��<V
c$�|"S��T"�Xl:~�s$��<��|�B�ޜ����`S��	�<�'�/���ݶHA�
�5�+)6�Tt�`���������w;eA�%`��
����J����� �����\ߪ�m�� rg�h��PP�Jd"�K�%�!!��}���.���8��]��yT{�� �r�x��h�s�T�љ� >b�4 2)O�wP��RƮ�c\�½��"�͡"6�!h�1"m�� R���ܩ
H��/5�/���ަ��������Wڤ��o�����|w��Ql݁7���-t���Y��2ο�y
Z����270a96e6e680a6a82e3682c977cf09f92c3a04cdace34830d784f899e26be9b9e43ba877ca1a6c905551d598b4b7ced8a4c88731g�0	G��g�*etdrv] net/mlx5e: Fix slab-out-of-bounds in mlx5e_rep_is_lag_netdev (Alaa Hleihel) [1858560]
- [netdrv] net/mlx5: Verify Hardware supports requested ptp function on a given pin (Alaa Hleihel) [1858560]
- [netdrv] net/mlx5: Fix a bug of using ptp channel index as pin index (Alaa Hleihel) [1858560]
- [netdrv] net/mlx5e: Fix missing cleanup of ethtool steering during rep rx cleanup (Alaa Hleihel) [1858560]
- [netdrv] net/mlx5e: Fix error path of device attach (Alaa Hleihel) [1858560]
- [netdrv] net/mlx5: Fix forward to next namespace (Alaa Hleihel) [1858560]
- [netdrv] net/mlx5: E-switch, Destroy TSAR after reload interface (Alaa Hleihel) [1858560]
- [netdrv] net/mlx5: E-switch, Destroy TSAR when fail to enable the mode (Alaa Hleihel) [1858560]
- [infiniband] RDMA/mlx5: Fix prefetch memory leak if get_prefetchable_mr fails (Alaa Hleihel) [1858560]
- [infi�x�������������4�����X�
F�	?Fhh���h<����5F�$����������������
55
�Et�?pd
�
�
�
�	!
�	V
��
��
��
��
�	�
��
�

�

�

z
l	�
'�8<
V

"8
2�
[�
�

�0
��
��	
��	
��	(
��
8
��(9
�\(:
�A(=
�

>
�
F
�
G
�4H
ʜI
�X
� Y
�(\
�D]
�^ ��bH�
dJ%
eJ*
fJ-
lJ/
tJHuZ�vkzo��o�
�o�
�o�
�p


p

p

p(

pQ
�p�

p�t�
gt�
ht�
Clwdbadmin-python31.0.222.el8Database libs and command lines for Locaweb machinesDatabase extension for Locaweb Hosting Management APIg2?lwdbadminbuild
M$�Locaweb LicenseApplications/Databaseshttps://code.locaweb.com.br/ct-banco/lwdbadmin-python3linuxx86_64/usr/bin/getent group lwprovisioning >/dev/null || /usr/sbin/groupadd -r lwprovisioning
/usr/bin/getent group lwdbadmin >/dev/null || /usr/sbin/groupadd -g 260 -o -r lwdbadmin
/usr/bin/getent passwd lwdbadmin >/dev/null || \
    /usr/sbin/useradd -r -g lwdbadmin -G lwprovisioning -d /opt/lc/lwdbadmin -s /sbin/nologin -c "lwdbadmin daemon user" lwdbadmin
exit 0/usr/bin/echo -e 'y\n' | /usr/bin/ssh-keygen -q -b 4096 -t rsa -N '' -f /opt/lc/lwdbadmin/etc/lwdbadmin.key 2>&1 >/dev/null
/bin/chown lwdbadmin:lwprovisioning /opt/lc/lwdbadmin/etc/lwdbadmin.key
/bin/chown lwdbadmin:lwprovisioning /opt/lc/lwdbadmin/etc/lwdbadmin.key.pub
/bin/chmod 640 /opt/lc/lwdbadmin/etc/lwdbadmin.key
/bin/chmod 640 /opt/lc/lwdbadmin/etc/lwdbadmin.key.pub
/usr/bin/setfacl -m u:piglet:r-- /opt/lc/lwdbadmin/etc/lwdbadmin.key /opt/lc/lwdbadmin/etc/lwdbadmin.key.pub
/usr/bin/ln -sf /opt/lc/piglet/etc/linuxadmin.yml /opt/lc/lwdbadmin/etc/linuxadmin.yml
# create symlinks to /usr/bin
/usr/bin/ln -sf /opt/lc/lwdbadmin/bin/lwmyctrl /usr/bin/lwmyctrl
/usr/bin/ln -sf /opt/lc/lwdbadmin/bin/lwmysrvadm /usr/bin/lwmysrvadm
/usr/bin/ln -sf /opt/lc/lwdbadmin/bin/lwmyauth /usr/bin/lwmyauth
/usr/bin/ln -sf /opt/lc/lwdbadmin/bin/lwdbprovd /usr/bin/lwdbprovd
/usr/bin/ln -sf /opt/lc/lwdbadmin/bin/audit-service /usr/bin/audit-service
/bin/chown lwdbadmin:lwprovisioning /opt/lc/lwdbadmin/bin/lw*
/usr/bin/systemctl restart uwsgi

# Jairo Lenfers - 24-01-2024
#%posttrans
#[ -e /etc/locaweb/aka.key ] && setfacl -m u:lwdbadmin:r /etc/locaweb/aka.key��6
�
��Lh��
��

/mh<�/q7B�����
'L#/s�>Y�J�/s��K�(x��
������Q����
�8
�
�
��-�.�e\�,�Bx� \}
e�=&�$���nn��	�
6*$ lB��t�d��"��(��l�l�/�A�
�3aZ���[1�D~���8l��+
T|+_�?��	�&Y��s
�2/�4��AY��_��'}��&*3>k]/
�;�D
��\�GG�dG"h�I#�	�O%l���\
�+�����&�-O���|�Y'J�"��
�T)E�Q-LW�/��x��������������#�����X�
 p�?jit !������H.3.2�$;����������������
�H�H
�e/locale/ia/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/ilo/LC_MESSAGES//usr/share/locale/is/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ka/LC_MESSAGES//usr/share/locale/kk/LC_MESSAGES//usr/share/locale/km/LC_MESSAGES//usr/share/locale/kn/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/kw/LC_MESSAGES//usr/share/locale/kw@kkcor/LC_MESSAGES//usr/share/locale/kw@uccor/LC_MESSAGES//usr/share/locale/kw_GB/LC_MESSAGES//usr/share/locale/ky/LC_MESSAGES//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/lv/LC_MESSAGES//usr/share/locale/mai/LC_MESSAGES//usr/share/locale/mk/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mn/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/my/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nds/LC_MESSAGES//usr/share/locale/ne/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/nso/LC_MESSAGES//usr/share/locale/or/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/si/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@latin/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/te/LC_MESSAGES//usr/share/locale/tg/LC_MESSAGES//usr/share/locale/th/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/tw/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/ur/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/wba/LC_MESSAGES//usr/share/locale/yo/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_HK/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/locale/zu/LC_MESSAGES//usr/share/man/man5//usr/share/man/man8//var/run/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x�������������������X�
ke�?uild(�������p����o-st�$+����������������
��
�I+T?&8d
�
�
�
�	
�	E
��
��
��
�

�

�

�

�	
1
�
N
�
}
�
�
�
�

�
 
	:

T
�
�


@
�
�
�
�
�
�
(�
8�09p0:m0={
G�
H�
I�
X�Y \ 4
] h
^!%b"
d#T
e#Y
f#\
l#^
t#x
u#�
v#�w%X
x%�
y%�
�%�
�%�
�%�
�&4


&H

&L6
(�
(�6

*�

*�
�+4

+8
+H
g+L
h+P
Clibutempter1.1.614.el8A privileged helper for utmp/wtmp updatesThis library provides interface for terminal emulators such as
screen and xterm to record user sessions to utmp and wtmp files.`s�#ord1-prod-x86build002.svc.aws.rockylinux.orgȭKojiRockyLGPLv2+infrastructure@rockylinux.orgSystem Environment/Librariesftp://ftp.altlinux.org/pub/people/ldv/utempterlinuxx86_64{
    /usr/sbin/groupadd -g 22 -r -f utmp || :
    /usr/sbin/groupadd -g 35 -r -f utempter || :
}*).h0 �g�A�A�A�����A��A큤A큤`s�"`s�"`s�"`s�"`s�"`s�"`s�"`s�"`s�"`s�"L��
`s�"L��
0ed14fd384892f3ef1ae451a53afac198ba2d32cdb8db6ab3264cbfb7383c7c3f5d543f6b970a8c657795acbb795f0987ce4032a769097a1e2dd8f48b60464b226eec34c8bb47cab724e0f68a1bd9af9cdf338dc3141a8be439bad2d5a26b08da9bdde5616ecdd1e980b44f360600ee8783b1f99b8cc83a2beb163a0a390e861../../../../usr/lib64/libutempter.so.1.1.6../../../../usr/libexec/utempter/utempterlibutempter.so.1.1.6�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootutempterutmprootrootrootrootlibutempter-1.1.6-14.el8.src.rpm����������������������������������������������������libutempterlibutempter(x86-64)libutempter.so.0()(64bit)libutempter.so.0(UTEMPTER_1.1)(64bit)utempter@@@







@/bin/shlibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)shadow-utils3.0.4-14.6.0-14.0-15.2-14.14.3Z���Zz�@Zu�@Y�@Yx�@X��@V�=@U�a@S�@S�@S���Q��Q
"@Pv��P��O�MQ0@Jj�I�2�G��G1��F��DȪ�D��DĶ@C�q�Cx@A:��>L�@>��=�S�<�6�<��;��@;�@;�s�;�@;��;��@;ʼn�;;@:,�9}�@9%,�8�@8��7_��7W��Miroslav Lichvar <mlichvar@redhat.com> - 1.1.6-14Fedora Release Engineering <releng@fedoraproject.org> - 1.1.6-13Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 1.1.6-12Fedora Release Engineering <releng@fedoraproject.org> - 1.1.6-11Fedora Release Engineering <releng@fedoraproject.org> - 1.1.6-10Fedora Release Engineering <releng@fedoraproject.org> - 1.1.6-9Fedora Release Engineering <releng@fedoraproject.org> - 1.1.6-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.6-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.6-6Tom Callaway <spot@fedoraproject.org> - 1.1.6-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.6-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.6-3Miroslav Lichvar <mlichvar@redhat.com> - 1.1.6-2Miroslav Lichvar <mlichvar@redhat.com> - 1.1.6-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.5-7Fedora Release Engineering <rel-eng@lists.fedoraproject.�x�������������p�����X�
o �?nder��������������+�unne�$;����������������
+�,�*�
�d6d5a243f63f96a05420e294bf15127de2c5cd1508fbd51ccf1b669607ce692cecce426eaa53d7bcb0e87f5bbb99e7a4b174caaa4e0a7c6e9e6b317c2deffdaa0bc029a554d71359f67beaa121865baacff71befff479e623f103db7781625f9e51945d258674e35a49a14a4ce288a54521a538c7137c602826ee4d143febf8826421b0ff1f524681c42001f08510b05e3cc2d86c9e62a32c33dd0d7413057df46cd474093b82b16a38d6ef292e7a7c1a2eb20ec28aba018259d644e0bffe411c5b945a028e2b2fdbce9d536d8a62476b6a48b0c64cffd62baad61f44309f29c4329bea474526e8c3af35612360eae824f61c3006a8ffc37bc52d3e70cd4a24e592ddd1500ab20123a2605c7f8bfa09f9e07289afeba42f527f9edff393b58aeff5a580edbb5323edcb112f978c0e0180b89fce93e9f40bd998c8f2b538faf980c64bf3ba4ea9491b154ef64ba50327750bab066a512fbcef48c4df2d6d76edfe469a4f14a85898e61529b12b81777588630959e16722756fb3a25455553204d2d4a08d7339ae50a635d535b0e556a1639ef86ad8bfe00f64bb369fcb33c495b6a96ce05a508afcca257ce70c52a8c7faa51cd05f484b4b4d29c142ea7f0487e00bd3ac8aaa5f3342a0ff540a96cc93a16029705552e38e4180f6c60e04a1bd227224233dfad4b7b58fa3be92dae009ba0082088327a7dadf8540cb7cdb0309f28b45e1478c078199ebe96bdd79f201b92f954bd46e62cc35eff6e8ab90cde1b19e3566e4a92a4b58a9f8623159d3ff458a82288d75f9cc5c577bf23bd4d31f52b21a50879b575d4d8c10467eb2f2233052790cf19c4ce5aa10b91da4d3f2e8fe2d4cf56a26485be3935c17659e30d7880f762ea26b0363efaa41ddedc625b4342461b780011ee48d27d3b4125882de0cad2d918a64a00c4d62cce38be31a0aca291c5182194f225ff3c73527c9dd8d112ad3208f1b63ec85bf17c26e23effab7c1522757d7249be519b306a7d1085cca0b805c02def415aca18de40b653e11c6ff0beced2f4076bab0d90e7a438d97d446655ff8bd98215155d8b2814eb03da9cfa0aa03e0dbde3ef5ea70d8bbe880c9bd9729de2e2ea81442dc2fee3e2b80c9c4b6dfaee28aab9a685b592f09c729dcdd61c11932d52c3f159937b489f4f807cd4a7cf2dc2d04ea4a244e7721f0151f8b5df787c2e0b54020350c253e47b99e9732b1723892a22f40b1fdedbab05299f6a794c9faceccf56601d5c88e3ff1917dd1ecbdbf98edaa8cc347ae613dafe99149d14b1b4fd0f341864762ab6efbdcc8d89883b001bfe15f38eac6e97cb43d321ac022f3da1c8a84981c81b06d674be5d1a33f0613083bcced260f486887dcec3d2ef62328e1a409c649024c2d141c2854ccf9665f4d960f141571ee2a9c1b424f13610155cb2a29dc141ef5d4c77ed3b886f4a49fbab1882f2a8cda2cacb9a22c6f2af63b31fd44d1f9ace743effa7abd352e31b7cd72629ec0a5bbbc151942efa073d446f48262ca2c467a68a3ac4d8a957828f74b113ad7accdbbc46c3d9f290e660464d99885128708d9e4a10e13a5373cedafee13c75766ba656dd91fee75e01d0a79935256b1b145da51b1243420e8bf61dc4c0cbf421b015cf619a1b14f42a8b052039cc60a1e8840e90f8d851cfad3dadcb282254e1ea330c98250359ac8b999e82537d6fd5c41173c071a20521fcc8790096cc2a015ba9a5456852d8e6c40c81f21418f2ebe37ff4ec972a1db41b9982ed228d25f4d9ae256a3b3bd98349fba6caa3d8ff1ca02c5cbedc694fba896aacb873577cb929610627d8e992bc10032c56c5f11965c6c7743644bff991e962b36d2b717ed3a5dcee4ac95ee1ddbd571ad93fd140abd912f563c5926f1b0a2555255552c8f0f75f071fd1fc439436eab14625e9c3aa6cc01e49e22a9234ad03bf101c5a21e45e30389e399bde6a4b42c3f911b4a359677304b6c6bf6646bc284744dd8e17e02dffbcd6672d2e79243de5377f7d34f53a5df13aa2aef6f6b2344094cb07e8c0113c212249c59644e459e8ed62287bb243b5d186d6d14814fc581f3e6bc79c40583d263698ec557d366b175c6de070025ccedf57833bee04c894b0a03b501120b719128b95715bc448891b36340f1e77903690c7ff37a8ae5ab100e43c77eaee4aead5158159e95602d6b3ef9d8d0e4cf0fba7d53a8dc7dd2afaf533f20b9cff6f8b7de5871ea09da87ffc22b0e73debe95edaa6724db548749fdec336243e456d035c109fce69b53ebf79b85f423d8d29fde4f15ba260206d2969e4fb7f06a3bbf7d33a01b6af159915bedb884a9ba4110d5a09874b3031c42b68a293d01dd690490631da119dfe573cc752981071c4520e43224b84e460c6afcf419db843206d2d5136649259ce966072a7d3f7ca5b5c38540749760680902316396058cc8b6f42f9392d7cf933f238a3588bcf0578732c1dc15b77fc61961b6febd7d39b9c788c0417aa98bf8dffb7e0fcf30cb351c06005821850944a96cb24429db4e2a134ee5ec01098f97cc23b77288effb8ba629d16ee7e02f55a5684c2eb6a5d458820056ac3ec15e3bd2e5b10eb91ddf867f67c6aca94606785e131b3307e3b213f9069730c5a8e5f1ec07345f5e395f816d68e735550057af815ecadf4a362dab166727ed3183a0cdf1ab726e5161342aa5567c9bc0da8cce8926680eeb24eb7466a5e61395f546c76efbcfa3da4a7f377eb77aa90f3c5fc263fb83b944162355117b738ccd6e5c6a2d85a0cdbdf414453f55f2ef16d7c5cc23a9d04a86bc7ceadb21943c417105d8�x��������������������X�
Re�	?es: �������������#5ull �$3����������������
#5"5$5
�67320de40d769ca4510f50a6e15a64fb92d1f6b8a6bdcf8b1693f53cf3778368c95e8256119ded2ffd67e539caf31601fb592af0ba932b7b39779eac646248c26292319a3861838011f21822e1065d1189a4f88ed1fceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f1508cfc7749b96f63bd31c3c42b5c471bf756814053e847c10f3eb003417bc523d30854e7a19aefee33b713c3bce6286785d8af2aa2afab23e5a368b1ab8bf4e41efcd20cfd7f647e0856977d076b64607a9658d2bfd5ce7274988cb4c87c351c561e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855a6472d658cd44b8018567e9d27eef7ebb389662bc5d9ef1103d6ff6418e27f5f34dc56a92f2128d261d9c5176b545938c5fad9525fc9df14468d53b189d1fcc5ceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f15083e7df25b8dfb658c9a91501930d4d943b05087a8347c7e2b4325616af535047b1af4c4400f722a3d27bcfe269277e81a932f8da2570908d000d7101eb46b0317cd798b0b84c1fa505977420a806639ae6a4947d5f34d278737dcb438f3b9992d9064fbe0b5b245466b2f85602e1ebf835d8879597ff6ef5956169dae05d9504673e94f712ef82fff0aa07ec813a3d0179a1fca2ad140d57856191b48520f7963594129e43d1fb87047f50f1cd5f62f47678a59f8fe08d8212dfd8c32540b2352d094559c35be270fb7223565a3c8def6b6c0729e8aa3bb681c09c1e738bb8744a1909ddcf961abebe457e42e12c69a85c7fe8d423af8780ab2b00bf60bc5cee595de5ecc4f72cc82452150147f0edecc94a5322e275ca342cdf9aa8cec904cda193318954816997779c09572a2f5d8d6acf302a8f1cc2a55560d3aeb874a181b1d678eadf61d098d2ee57698844d62eb4b95c84df231675cc73102517f83a89cca2e8c72ac6ff3c279b9ef24e7e9951b1877889dfb883e10c85fac59c1a30befc42a6321beaf39479b049a5d89f89d6f4f32ed7800b0edd3d603465c94fddfecffccb78b9d9b2fa4942b6d4a984125d2acc7c5efb47994738d91a45a0f2043807c8c410076110b8d7ca0a179d8cef16fcfca323dcafad1f1d13cd988ac318cf3ab8b3ce90c11b1845adb42fdb9e4b17e1fa13e28697ed0630cebd86b6fd24b6652d0b7ca54d6a79ff530a03e3cb0aec0a411f3348e9e51ae18621dce3f314bdf30a92c9cde344de84f86055fc422618e3fc18cbf78ddaa6b78004a633f9b9746ed0a25e7bc7bd361d9c2303764ba7ef38094116ab511e856f8debb5b38218be379ab520e444b811afa5f7fa1a0393f49042fd3ae51d0174bd8aedf439e028153d8960d798b6b3f3d49ccb48b3b77781ac4bccc953c8d8fc8fc2475548f605ab0f2d2cea04cad71aa6f5abaf525f09fec3a20fb0ba506d4b562b0ecf12ec97cca8ff7d5348c8358345593b79632a42d941c36030512579253aed4f9f25ef38acd5cbeec90f50ae1c6ca89e93af13d2f3286fe2f86242112dbd8a5f885d31956f397556d0700e90ad4e46a58184050123beae3faf11ddc319847c83e7908cd1755242bec8459cd7f8bf39295dceae3c2ca0d3ba8635f65a559a31ac5ab3565285b130296a85216971ea46ce78314884c1698c9f7ea72175e34139a2e2a0aeb61f6492bcc14f6424d5314d5459ae333ab7e160c0dd476c06da64b41391b32610ec84c621301470d5a5ab61b0836c2fe542b6ca47537782d84e4fc470924e0a91887a07c83f5d9d1d43517ee1778dab71a98c9c5ad6863519cfb1384baa9059241be707e70814f9eef4c1dd2e4b280d4792050a79d772b47d58bc093cc1f6d9b854ccad1738009c699bf61bddb019672baf2a759bff6ba8d81485d3e954806fad33f172f8fac22e7508edfc7fa395b2a589d403358033413d779c8bf1f15154a7df69b6f08ab92460850962e169f13bdfe88ebf0ffd8031aa9f2b56dcd907a5bba00e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8553015d33825d2c9ec0c72e95a4658811333d590e2972e244caaf2178a1f4092b8d44efd7f7bf2b31ca0c9f64c86f47afb21437f2b119f71a8f31653cb0b5e878a6e9c5ac8ce0852715001df1b519dcf16c1689a2f5049f064fb44c95f2294d8527a13eb656e1dee9704bd7180129b0a80b757a459c8403f77c85ed3fe31e3a11952bf315e456fc8573a9b9080df842b1c16ac003bd2fcd3c5b1653e4377e54580fea5e00da630b079edbe920a48a5e9d6bad8220b6ae99f692f22e73b65cda0bdceebae7b8927a3227e5303cf5e0f1f7b34bb542ad7250ac03fbcde36ec2f1508db3f0246b1f9278f15845b99fec478b8b506eb76487993722f8c6e254285faf8f58122690938e7a4e1656bba51864f8fcf66a5c5f74e9bfe9601f2c35de482bfe5b1dd2319d1fb566b6d55cee9106f46f0fcdb07ed81260d6054e399be2274fc7b0c04b9e8a8d42d977874ef4f5ee7f1d6542603afc82582b7459534b0a53fdac299e12eb6edca4e21675a820b0e3c7024b1a103f350b32122e685aac07b1b1477dc8bdfdbff5bbaa62830d21fab13e1b1348ff2ecd4cdcfd7ad4e1a076c9b88e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b85597b50ba3c8c693ee3ef236da726279f1c6294915f8b304b571c6c968954019d38d4f7e76d7efe9c2a6b5024e5cdf273f59a6ee038dc3990a12d88fb5bc276722dd8b647da746a14e7b54c110164d9337231956e77590391a��������x�������������X����

�������������������P�����l�����
�����������������������������m���������{��+#